Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P19438 (TNR1A_HUMAN)

Entry version 249 (07 Apr 2021)
Sequence version 1 (01 Feb 1991)
Previous versions | rss
Add a publicationFeedback
Protein

Tumor necrosis factor receptor superfamily member 1A

Gene

TNFRSF1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processApoptosis, Host-virus interaction

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P19438

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5357786, TNFR1-induced proapoptotic signaling
R-HSA-5357905, Regulation of TNFR1 signaling
R-HSA-5357956, TNFR1-induced NFkappaB signaling pathway
R-HSA-5626978, TNFR1-mediated ceramide production
R-HSA-5669034, TNFs bind their physiological receptors
R-HSA-6783783, Interleukin-10 signaling
R-HSA-75893, TNF signaling

SIGNOR Signaling Network Open Resource

More...SIGNORi		P19438

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 1A
Alternative name(s):
Tumor necrosis factor receptor 1
Short name:
TNF-R1
Tumor necrosis factor receptor type I
Short name:
TNF-RI
Short name:
TNFR-I
p55
p60
CD_antigen: CD120a
Cleaved into the following 2 chains:
Tumor necrosis factor receptor superfamily member 1A, membrane form
Tumor necrosis factor-binding protein 1
Short name:
TBPI
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TNFRSF1A
Synonyms:TNFAR, TNFR1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:11916, TNFRSF1A

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		191190, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P19438

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000067182.7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini30 – 211ExtracellularSequence analysisAdd BLAST182
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei212 – 232HelicalSequence analysisAdd BLAST21
Topological domaini233 – 455CytoplasmicSequence analysisAdd BLAST223

Keywords - Cellular componenti

Cell membrane, Golgi apparatus, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Periodic fever, familial, autosomal dominant (FPF)5 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA hereditary periodic fever syndrome characterized by recurrent fever, abdominal pain, localized tender skin lesions and myalgia. Reactive amyloidosis is the main complication and occurs in 25% of cases.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01932951H → Q in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895254EnsemblClinVar.1
Natural variantiVAR_01341059C → R in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895217EnsemblClinVar.1
Natural variantiVAR_01930259C → S in FPF. 2 PublicationsCorresponds to variant dbSNP:rs104895223EnsemblClinVar.1
Natural variantiVAR_01930362C → G in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895225EnsemblClinVar.1
Natural variantiVAR_01341162C → Y in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895218EnsemblClinVar.1
Natural variantiVAR_01933075P → L in FPF; benign variant. 2 PublicationsCorresponds to variant dbSNP:rs4149637EnsemblClinVar.1
Natural variantiVAR_01341279T → M in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895219EnsemblClinVar.1
Natural variantiVAR_01341381C → F in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895220EnsemblClinVar.1
Natural variantiVAR_01930499C → S in FPF. 2 PublicationsCorresponds to variant dbSNP:rs104895228EnsemblClinVar.1
Natural variantiVAR_019331115S → G in FPF. 1 Publication1
Natural variantiVAR_013414117C → R in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895221EnsemblClinVar.1
Natural variantiVAR_013415117C → Y in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895222EnsemblClinVar.1
Natural variantiVAR_019305121R → P in FPF. 1 PublicationCorresponds to variant dbSNP:rs4149584EnsemblClinVar.1
Natural variantiVAR_019332121R → Q in FPF; unknown pathological significance. 2 PublicationsCorresponds to variant dbSNP:rs4149584EnsemblClinVar.1
Multiple sclerosis 5 (MS5)1 Publication
Disease susceptibility is associated with variants affecting the gene represented in this entry. An intronic mutation affecting alternative splicing and skipping of exon 6 directs increased expression of isoform 4 a transcript encoding a C-terminally truncated protein which is secreted and may function as a TNF antagonist.
Disease descriptionA multifactorial, inflammatory, demyelinating disease of the central nervous system. Sclerotic lesions are characterized by perivascular infiltration of monocytes and lymphocytes and appear as indurated areas in pathologic specimens (sclerosis in plaques). The pathological mechanism is regarded as an autoimmune attack of the myelin sheath, mediated by both cellular and humoral immunity. Clinical manifestations include visual loss, extra-ocular movement disorders, paresthesias, loss of sensation, weakness, dysarthria, spasticity, ataxia and bladder dysfunction. Genetic and environmental factors influence susceptibility to the disease.
Related information in OMIM

Keywords - Diseasei

Amyloidosis, Disease variant

Organism-specific databases

DisGeNET

More...DisGeNETi		7132

MalaCards human disease database

More...MalaCardsi		TNFRSF1A
MIMi142680, phenotype
614810, phenotype

Open Targets

More...OpenTargetsi		ENSG00000067182

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		329967, Intermittent hydrarthrosis
802, NON RARE IN EUROPE: Multiple sclerosis
32960, Tumor necrosis factor receptor 1 associated periodic syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36609

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P19438, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3378

Drug and drug target database

More...DrugBanki		DB03507, 6-[3-(4-Morpholinyl)Propyl]-2-(3-Nitrophenyl)-5-Thioxo-5,6,-Dihydro-7h-Thienol[2',3':4,5]Pyrrolo[1,2-C]Imidazol-7-One
DB11626, Tasonermin

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TNFRSF1A

Domain mapping of disease mutations (DMDM)

More...DMDMi		135959

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 291 PublicationAdd BLAST29
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000003454330 – 455Tumor necrosis factor receptor superfamily member 1A, membrane formAdd BLAST426
ChainiPRO_000003454441 – 201Tumor necrosis factor-binding protein 1Add BLAST161

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi44 ↔ 58
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi54N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi59 ↔ 72
Disulfide bondi62 ↔ 81
Disulfide bondi84 ↔ 99
Disulfide bondi102 ↔ 117
Disulfide bondi105 ↔ 125
Disulfide bondi127 ↔ 143
Glycosylationi145N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi146 ↔ 158
Disulfide bondi149 ↔ 166
Glycosylationi151N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi168 ↔ 179
Disulfide bondi182 ↔ 195
Disulfide bondi185 ↔ 191

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The soluble form is produced from the membrane form by proteolytic processing.

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P19438

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P19438

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P19438

MaxQB - The MaxQuant DataBase

More...MaxQBi		P19438

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P19438

PeptideAtlas

More...PeptideAtlasi		P19438

PRoteomics IDEntifications database

More...PRIDEi		P19438

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		53659 [P19438-1]
53660 [P19438-2]
53661 [P19438-3]
5939

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P19438, 3 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P19438

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P19438

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P19438

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000067182, Expressed in tendon of biceps brachii and 237 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P19438, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P19438, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000067182, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binding of TNF to the extracellular domain leads to homotrimerization. The aggregated death domains provide a novel molecular interface that interacts specifically with the death domain of TRADD. Various TRADD-interacting proteins such as TRAFS, RIPK1 and possibly FADD, are recruited to the complex by their association with TRADD. This complex activates at least two distinct signaling cascades, apoptosis and NF-kappa-B signaling.

Interacts with BAG4, BABAM2, FEM1B, GRB2, SQSTM1 and TRPC4AP (PubMed:10356400, PubMed:10359574, PubMed:10542291, PubMed:15465831, PubMed:8387891, PubMed:9915703).

Interacts directly with NOL3 (via CARD domain); inhibits TNF-signaling pathway (By similarity).

Interacts with SH3RF2, TRADD and RIPK1. SH3RF2 facilitates the recruitment of RIPK1 and TRADD to TNFRSF1A in a TNF-alpha-dependent process (PubMed:24130170).

Interacts with PGLYRP1; this interaction is important for cell death induction (PubMed:26183779).

By similarity8 Publications

(Microbial infection) Interacts with mumps virus protein SH; this interaction inhibits downstream NF-kappa-B pathway activation.

1 Publication

(Microbial infection) Interacts with HCV core protein.

1 Publication

(Microbial infection) Interacts with human cytomegalovirus/HHV-5 protein UL138.

1 Publication

(Microbial infection) Interacts with host TNFRSF1A; this interaction leads to the stimulation of both surface expression and shedding of TNFRSF1A.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		112986, 195 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P19438

Database of interacting proteins

More...DIPi		DIP-407N

Protein interaction database and analysis system

More...IntActi		P19438, 98 interactors

Molecular INTeraction database

More...MINTi		P19438

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000162749

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P19438

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P19438, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1455
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		P19438

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P19438

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P19438

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati43 – 82TNFR-Cys 1Add BLAST40
Repeati83 – 125TNFR-Cys 2Add BLAST43
Repeati126 – 166TNFR-Cys 3Add BLAST41
Repeati167 – 196TNFR-Cys 4Add BLAST30
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini356 – 441DeathPROSITE-ProRule annotationAdd BLAST86

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni338 – 348N-SMase activation domain (NSD)Add BLAST11

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The domain that induces A-SMASE is probably identical to the death domain. The N-SMASE activation domain (NSD) is both necessary and sufficient for activation of N-SMASE.
Both the cytoplasmic membrane-proximal region and the C-terminal region containing the death domain are involved in the interaction with TRPC4AP.By similarity

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S050, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159540

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_050864_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P19438

Identification of Orthologs from Complete Genome Data

More...OMAi		VLCDMDL

Database of Orthologous Groups

More...OrthoDBi		976094at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P19438

TreeFam database of animal gene trees

More...TreeFami		TF333916

Family and domain databases

Conserved Domains Database

More...CDDi		cd08313, Death_TNFR1, 1 hit
cd10576, TNFRSF1A, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011029, DEATH-like_dom_sf
IPR000488, Death_domain
IPR001368, TNFR/NGFR_Cys_rich_reg
IPR020419, TNFR_1A
IPR033994, TNFRSF1A_death
IPR033993, TNFRSF1A_N

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00531, Death, 1 hit
PF00020, TNFR_c6, 3 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01918, TNFACTORR1A

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00005, DEATH, 1 hit
SM00208, TNFR, 4 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47986, SSF47986, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50017, DEATH_DOMAIN, 1 hit
PS00652, TNFR_NGFR_1, 3 hits
PS50050, TNFR_NGFR_2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P19438-1) [UniParc]FASTAAdd to basket
Also known as: FL-TNFR1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGLSTVPDLL LPLVLLELLV GIYPSGVIGL VPHLGDREKR DSVCPQGKYI 
        60         70         80         90        100
HPQNNSICCT KCHKGTYLYN DCPGPGQDTD CRECESGSFT ASENHLRHCL 
       110        120        130        140        150
SCSKCRKEMG QVEISSCTVD RDTVCGCRKN QYRHYWSENL FQCFNCSLCL 
       160        170        180        190        200
NGTVHLSCQE KQNTVCTCHA GFFLRENECV SCSNCKKSLE CTKLCLPQIE 
       210        220        230        240        250
NVKGTEDSGT TVLLPLVIFF GLCLLSLLFI GLMYRYQRWK SKLYSIVCGK 
       260        270        280        290        300
STPEKEGELE GTTTKPLAPN PSFSPTPGFT PTLGFSPVPS STFTSSSTYT 
       310        320        330        340        350
PGDCPNFAAP RREVAPPYQG ADPILATALA SDPIPNPLQK WEDSAHKPQS 
       360        370        380        390        400
LDTDDPATLY AVVENVPPLR WKEFVRRLGL SDHEIDRLEL QNGRCLREAQ 
       410        420        430        440        450
YSMLATWRRR TPRREATLEL LGRVLRDMDL LGCLEDIEEA LCGPAALPPA 

PSLLR
Length:455
Mass (Da):50,495
Last modified:February 1, 1991 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4CEFBA96D03B8225
GO
Isoform 2 (identifier: P19438-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-108: Missing.

Show »
Length:347
Mass (Da):38,651
Checksum:i8C629DAF8D7BA515
GO
Isoform 4 (identifier: P19438-4) [UniParc]FASTAAdd to basket
Also known as: Delta6-TNFR1

The sequence of this isoform differs from the canonical sequence as follows:
     184-455: NCKKSLECTK...ALPPAPSLLR → KHHSAVAPGH...LLHCLWEIDT

Note: Disease-associated isoform. Isoform 4 splicing pattern is driven by a variation in the exon 6/intron 6 boundary region that alters exon 6 splicing. Exon 6 skipping introduces a frameshift and the translation of a protein lacking the intracellular, the transmembrane and part of the extracellular domain.Curated
Show »
Length:228
Mass (Da):25,577
Checksum:iA67C489AF6DDBFEC
GO
Isoform 3 (identifier: P19438-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-232: Missing.

Show »
Length:223
Mass (Da):24,794
Checksum:i31BDA9ACAEF12FC3
GO
Isoform 5 (identifier: P19438-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     184-218: NCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVI → KVLLCRPGWNAVARSRLTATSASQIQAILLLQPPK
     219-455: Missing.

Show »
Length:218
Mass (Da):24,194
Checksum:iFBDD906CEF26F405
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H8A6F5H8A6_HUMAN
Tumor necrosis factor receptor supe...
TNFRSF1A
298Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H061F5H061_HUMAN
Tumor necrosis factor receptor supe...
TNFRSF1A
412Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H6V7F5H6V7_HUMAN
Tumor necrosis factor receptor supe...
TNFRSF1A
254Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H6Z2F5H6Z2_HUMAN
Tumor necrosis factor receptor supe...
TNFRSF1A
118Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GWJ4F5GWJ4_HUMAN
Tumor necrosis factor receptor supe...
TNFRSF1A
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H4T5F5H4T5_HUMAN
Tumor necrosis factor receptor supe...
TNFRSF1A
71Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H7N1F5H7N1_HUMAN
Tumor necrosis factor receptor supe...
TNFRSF1A
72Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti13L → LILPQ in BAG51763 (PubMed:14702039).Curated1
Sequence conflicti255K → E in BAG37891 (PubMed:14702039).Curated1
Sequence conflicti286S → G in BAG51763 (PubMed:14702039).Curated1
Sequence conflicti394R → L in BAF83777 (PubMed:14702039).Curated1
Sequence conflicti412Missing in AAA36756 (PubMed:2170974).Curated1
Sequence conflicti443 – 446GPAA → APP in AAA36756 (PubMed:2170974).Curated4

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01932951H → Q in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895254EnsemblClinVar.1
Natural variantiVAR_01341059C → R in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895217EnsemblClinVar.1
Natural variantiVAR_01930259C → S in FPF. 2 PublicationsCorresponds to variant dbSNP:rs104895223EnsemblClinVar.1
Natural variantiVAR_01930362C → G in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895225EnsemblClinVar.1
Natural variantiVAR_01341162C → Y in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895218EnsemblClinVar.1
Natural variantiVAR_01933075P → L in FPF; benign variant. 2 PublicationsCorresponds to variant dbSNP:rs4149637EnsemblClinVar.1
Natural variantiVAR_01341279T → M in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895219EnsemblClinVar.1
Natural variantiVAR_01341381C → F in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895220EnsemblClinVar.1
Natural variantiVAR_01930499C → S in FPF. 2 PublicationsCorresponds to variant dbSNP:rs104895228EnsemblClinVar.1
Natural variantiVAR_019331115S → G in FPF. 1 Publication1
Natural variantiVAR_013414117C → R in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895221EnsemblClinVar.1
Natural variantiVAR_013415117C → Y in FPF. 1 PublicationCorresponds to variant dbSNP:rs104895222EnsemblClinVar.1
Natural variantiVAR_019305121R → P in FPF. 1 PublicationCorresponds to variant dbSNP:rs4149584EnsemblClinVar.1
Natural variantiVAR_019332121R → Q in FPF; unknown pathological significance. 2 PublicationsCorresponds to variant dbSNP:rs4149584EnsemblClinVar.1
Natural variantiVAR_011813305P → T. Corresponds to variant dbSNP:rs1804532Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0371541 – 232Missing in isoform 3. 1 PublicationAdd BLAST232
Alternative sequenceiVSP_0371531 – 108Missing in isoform 2. 1 PublicationAdd BLAST108
Alternative sequenceiVSP_044949184 – 455NCKKS…PSLLR → KHHSAVAPGHFLWSLPFIPP LHWFNVSLPTVEVQALLHCL WEIDT in isoform 4. CuratedAdd BLAST272
Alternative sequenceiVSP_047613184 – 218NCKKS…LPLVI → KVLLCRPGWNAVARSRLTAT SASQIQAILLLQPPK in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_047614219 – 455Missing in isoform 5. 1 PublicationAdd BLAST237

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M58286 mRNA Translation: AAA36753.1
M33294 mRNA Translation: AAA03210.1
M63121 mRNA Translation: AAA36754.1
X55313 mRNA Translation: CAA39021.1
M60275 mRNA Translation: AAA36756.1
M75866, M75864, M75865 Genomic DNA Translation: AAA61201.1
AY131997 Genomic DNA Translation: AAM77802.1
AK056611 mRNA Translation: BAG51763.1
AK291088 mRNA Translation: BAF83777.1
AK298729 mRNA Translation: BAG60879.1
AK304517 mRNA Translation: BAG65321.1
AK315509 mRNA Translation: BAG37891.1
EU927389 mRNA Translation: ACH57451.1
AC006057 Genomic DNA No translation available.
CH471116 Genomic DNA Translation: EAW88805.1
CH471116 Genomic DNA Translation: EAW88806.1
BC010140 mRNA Translation: AAH10140.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS8542.1 [P19438-1]

Protein sequence database of the Protein Information Resource

More...PIRi		A38208, GQHUT1

NCBI Reference Sequences

More...RefSeqi		NP_001056.1, NM_001065.3 [P19438-1]
NP_001333020.1, NM_001346091.1 [P19438-2]
NP_001333021.1, NM_001346092.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000162749; ENSP00000162749; ENSG00000067182 [P19438-1]
ENST00000366159; ENSP00000380389; ENSG00000067182 [P19438-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7132

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7132

UCSC genome browser

More...UCSCi		uc001qnu.4, human [P19438-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

INFEVERS

Repertory of FMF and hereditary autoinflammatory disorders mutations

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M58286 mRNA Translation: AAA36753.1
M33294 mRNA Translation: AAA03210.1
M63121 mRNA Translation: AAA36754.1
X55313 mRNA Translation: CAA39021.1
M60275 mRNA Translation: AAA36756.1
M75866, M75864, M75865 Genomic DNA Translation: AAA61201.1
AY131997 Genomic DNA Translation: AAM77802.1
AK056611 mRNA Translation: BAG51763.1
AK291088 mRNA Translation: BAF83777.1
AK298729 mRNA Translation: BAG60879.1
AK304517 mRNA Translation: BAG65321.1
AK315509 mRNA Translation: BAG37891.1
EU927389 mRNA Translation: ACH57451.1
AC006057 Genomic DNA No translation available.
CH471116 Genomic DNA Translation: EAW88805.1
CH471116 Genomic DNA Translation: EAW88806.1
BC010140 mRNA Translation: AAH10140.1
CCDSiCCDS8542.1 [P19438-1]
PIRiA38208, GQHUT1
RefSeqiNP_001056.1, NM_001065.3 [P19438-1]
NP_001333020.1, NM_001346091.1 [P19438-2]
NP_001333021.1, NM_001346092.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1EXTX-ray1.85A/B41-201[»]
1FT4X-ray2.90A/B41-201[»]
1ICHNMR-A345-455[»]
1NCFX-ray2.25A/B41-201[»]
1TNRX-ray2.85R44-182[»]
7K7ANMR-A/B/C209-238[»]
7KP7X-ray2.65D/E/F42-184[»]
7KP8X-ray3.15E/F43-184[»]
7KPBX-ray3.00E/F42-184[»]
BMRBiP19438
SMRiP19438
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi112986, 195 interactors
CORUMiP19438
DIPiDIP-407N
IntActiP19438, 98 interactors
MINTiP19438
STRINGi9606.ENSP00000162749

Chemistry databases

BindingDBiP19438
ChEMBLiCHEMBL3378
DrugBankiDB03507, 6-[3-(4-Morpholinyl)Propyl]-2-(3-Nitrophenyl)-5-Thioxo-5,6,-Dihydro-7h-Thienol[2',3':4,5]Pyrrolo[1,2-C]Imidazol-7-One
DB11626, Tasonermin

PTM databases

GlyGeniP19438, 3 sites
iPTMnetiP19438
PhosphoSitePlusiP19438
SwissPalmiP19438

Genetic variation databases

BioMutaiTNFRSF1A
DMDMi135959

Proteomic databases

EPDiP19438
jPOSTiP19438
MassIVEiP19438
MaxQBiP19438
PaxDbiP19438
PeptideAtlasiP19438
PRIDEiP19438
ProteomicsDBi53659 [P19438-1]
53660 [P19438-2]
53661 [P19438-3]
5939

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		P19438, 8 sequenced antibodies

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1320, 1477 antibodies

The DNASU plasmid repository

More...DNASUi		7132

Genome annotation databases

EnsembliENST00000162749; ENSP00000162749; ENSG00000067182 [P19438-1]
ENST00000366159; ENSP00000380389; ENSG00000067182 [P19438-5]
GeneIDi7132
KEGGihsa:7132
UCSCiuc001qnu.4, human [P19438-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7132
DisGeNETi7132

GeneCards: human genes, protein and diseases

More...GeneCardsi		TNFRSF1A
HGNCiHGNC:11916, TNFRSF1A
HPAiENSG00000067182, Low tissue specificity
MalaCardsiTNFRSF1A
MIMi142680, phenotype
191190, gene
614810, phenotype
neXtProtiNX_P19438
OpenTargetsiENSG00000067182
Orphaneti329967, Intermittent hydrarthrosis
802, NON RARE IN EUROPE: Multiple sclerosis
32960, Tumor necrosis factor receptor 1 associated periodic syndrome
PharmGKBiPA36609
VEuPathDBiHostDB:ENSG00000067182.7

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502S050, Eukaryota
GeneTreeiENSGT00940000159540
HOGENOMiCLU_050864_0_0_1
InParanoidiP19438
OMAiVLCDMDL
OrthoDBi976094at2759
PhylomeDBiP19438
TreeFamiTF333916

Enzyme and pathway databases

PathwayCommonsiP19438
ReactomeiR-HSA-5357786, TNFR1-induced proapoptotic signaling
R-HSA-5357905, Regulation of TNFR1 signaling
R-HSA-5357956, TNFR1-induced NFkappaB signaling pathway
R-HSA-5626978, TNFR1-mediated ceramide production
R-HSA-5669034, TNFs bind their physiological receptors
R-HSA-6783783, Interleukin-10 signaling
R-HSA-75893, TNF signaling
SIGNORiP19438

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		7132, 8 hits in 1000 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TNFRSF1A, human
EvolutionaryTraceiP19438

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		TNFRSF1A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7132
PharosiP19438, Tchem

Protein Ontology

More...PROi		PR:P19438
RNActiP19438, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000067182, Expressed in tendon of biceps brachii and 237 other tissues
ExpressionAtlasiP19438, baseline and differential
GenevisibleiP19438, HS

Family and domain databases

CDDicd08313, Death_TNFR1, 1 hit
cd10576, TNFRSF1A, 1 hit
InterProiView protein in InterPro
IPR011029, DEATH-like_dom_sf
IPR000488, Death_domain
IPR001368, TNFR/NGFR_Cys_rich_reg
IPR020419, TNFR_1A
IPR033994, TNFRSF1A_death
IPR033993, TNFRSF1A_N
PfamiView protein in Pfam
PF00531, Death, 1 hit
PF00020, TNFR_c6, 3 hits
PRINTSiPR01918, TNFACTORR1A
SMARTiView protein in SMART
SM00005, DEATH, 1 hit
SM00208, TNFR, 4 hits
SUPFAMiSSF47986, SSF47986, 1 hit
PROSITEiView protein in PROSITE
PS50017, DEATH_DOMAIN, 1 hit
PS00652, TNFR_NGFR_1, 3 hits
PS50050, TNFR_NGFR_2, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTNR1A_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P19438
Secondary accession number(s): A8K4X3
, B2RDE4, B3KPQ1, B4DQB7, B4E309, B5M0B5, D3DUR1, Q9UCA4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: April 7, 2021
This is version 249 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again