Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 204 (11 Dec 2019)
Sequence version 1 (01 Nov 1990)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein sex-lethal

Gene

Sxl

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sex determination switch protein which controls sexual development by sex-specific splicing. Regulates dosage compensation in females by suppressing hyperactivation of X-linked genes. Expression of the embryo-specific isoform is under the control of primary sex-determining signal, which depends on the ratio of X chromosomes relative to autosomes (X:A ratio). Expression occurs in 2X:2A cells, but not in X:2A cells. The X:A ratio seems to be signaled by the relative concentration of the X-linked transcription factors SIS-A and SIS-B. As a result, the embryo-specific product is expressed early only in female embryos and specifies female-adult specific splicing; in the male where it is not expressed, the default splicing gives rise to a truncated non-functional protein. The female-specific isoform specifies the splicing of its own transcript, thereby initiating a positive autoregulatory feedback loop leading to female development pathway. The female-specific isoform controls the sex-specific splicing of transformer (TRA); acts as a translational repressor for male-specific lethal-2 (MSL-2) and prevents male-less (MLE), MSL-1 and MSL-3 proteins from associating with the female X chromosome.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding
Biological processDifferentiation, Sexual differentiation, Transcription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein sex-lethal
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Sxl
Synonyms:Sx1
ORF Names:CG43770
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0264270 Sxl

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000819671 – 354Protein sex-lethalAdd BLAST354

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P19339

PRoteomics IDEntifications database

More...
PRIDEi
P19339

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in somatic tissues, but not in the pole cells, which are the precursors of the germline.

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform 1 is embryo-specific. Isoform CM1 is male-specific. Isoforms MS3, MS11 and MS16 are female specific. Isoform 1 is expressed for a brief period during the syncytial blastoderm stage. Isoform MS11 is expressed in 4-7 hours embryo.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0264270 Expressed in 29 organ(s), highest expression level in embryo

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P19339 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P19339 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of a complex containing fl2d, Sxl and vir (PubMed:12444081).

Interacts with nito (PubMed:26324914).

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q9VSK38EBI-16120780,EBI-194879

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
533777, 111 interactors

Database of interacting proteins

More...
DIPi
DIP-44607N

Protein interaction database and analysis system

More...
IntActi
P19339, 9 interactors

Molecular INTeraction database

More...
MINTi
P19339

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0303693

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1354
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P19339

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P19339

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini125 – 203RRM 1PROSITE-ProRule annotationAdd BLAST79
Domaini211 – 291RRM 2PROSITE-ProRule annotationAdd BLAST81

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1 – 32Asn/Gly-richAdd BLAST32
Compositional biasi57 – 60Poly-Ser4
Compositional biasi312 – 319Poly-Pro8

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The Gly-Asn rich domain is required for the cooperative interaction with RNA and for regulating the splicing activity.

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IQXB Eukaryota
ENOG411112S LUCA

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P19339

KEGG Orthology (KO)

More...
KOi
K18747

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P19339

Family and domain databases

Database of protein disorder

More...
DisProti
DP01605

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.330, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002343 Hud_Sxl_RNA
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
IPR006546 Sxl

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00076 RRM_1, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00961 HUDSXLRNA

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00360 RRM, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54928 SSF54928, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01659 sex-lethal, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50102 RRM, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (14+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 14 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 14 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform MS3 (identifier: P19339-1) [UniParc]FASTAAdd to basket
Also known as: CF1, D, female-specific, L, T

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYGNNNPGSN NNNGGYPPYG YNNKSSGGRG FGMSHSLPSG MSRYAFSPQD
60 70 80 90 100
TEFSFPSSSS RRGYNDFPGC GGSGGNGGSA NNLGGGNMCH LPPMASNNSL
110 120 130 140 150
NNLCGLSLGS GGSDDLMNDP RASNTNLIVN YLPQDMTDRE LYALFRAIGP
160 170 180 190 200
INTCRIMRDY KTGYSFGYAF VDFTSEMDSQ RAIKVLNGIT VRNKRLKVSY
210 220 230 240 250
ARPGGESIKD TNLYVTNLPR TITDDQLDTI FGKYGSIVQK NILRDKLTGR
260 270 280 290 300
PRGVAFVRYN KREEAQEAIS ALNNVIPEGG SQPLSVRLAE EHGKAKAAHF
310 320 330 340 350
MSQMGVVPAN VPPPPPQPPA HMAAAFNMMH RGRSIKSQQR FQNSHPYFDA

KKFI
Length:354
Mass (Da):38,549
Last modified:November 1, 1990 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4E443D3BC88B134E
GO
Isoform 1 (identifier: P19339-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MYGNNNPGSNNNNGGYPPYGYNNKS → MDFNFDTVTPCSTMSSYYNFKMA

Show »
Length:352
Mass (Da):38,542
Checksum:iFD5C0EE4F86C8A29
GO
Isoform A (identifier: P19339-10) [UniParc]FASTAAdd to basket
Also known as: E, U

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     42-49: Missing.

Show »
Length:314
Mass (Da):34,304
Checksum:i8CB2DCA31C482659
GO
Isoform C (identifier: P19339-8) [UniParc]FASTAAdd to basket
Also known as: N

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MYGNNNPGSNNNNGGYPPYGYNNKS → MDFNFDTVTPCSTMSSYYNFKMA
     42-49: Missing.

Show »
Length:344
Mass (Da):37,605
Checksum:i98D4D7D547D4D55D
GO
Isoform CM1 (identifier: P19339-3) [UniParc]FASTAAdd to basket
Also known as: B, F, M

The sequence of this isoform differs from the canonical sequence as follows:
     26-48: SGGRGFGMSHSLPSGMSRYAFSP → RHIFFHSPERSSHHYHRKAKDTH
     49-354: Missing.

Show »
Length:48
Mass (Da):5,601
Checksum:i0900E728FB154B24
GO
Isoform G (identifier: P19339-7) [UniParc]FASTAAdd to basket
Also known as: J

The sequence of this isoform differs from the canonical sequence as follows:
     42-49: Missing.

Show »
Length:346
Mass (Da):37,612
Checksum:iDD93EDFA9C166C35
GO
Isoform W (identifier: P19339-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-49: Missing.
     333-354: RSIKSQQRFQNSHPYFDAKKFI → ENFADLLDGLYRRKYHYPYL

Show »
Length:344
Mass (Da):37,433
Checksum:i1093D98D4591E81E
GO
Isoform K (identifier: P19339-11) [UniParc]FASTAAdd to basket
Also known as: Q

The sequence of this isoform differs from the canonical sequence as follows:
     27-42: GGRGFGMSHSLPSGMS → PERSSHHYHRKAKDTH
     43-354: Missing.

Show »
Length:42
Mass (Da):4,763
Checksum:i7AFD03F36F4BEA11
GO
Isoform MS11 (identifier: P19339-4) [UniParc]FASTAAdd to basket
Also known as: H

The sequence of this isoform differs from the canonical sequence as follows:
     42-49: Missing.
     332-354: GRSIKSQQRFQNSHPYFDAKKFI → DGAMEKLRSLFDAICDAIFGLDSENFADLLDGLYRRKYHYPYL

Show »
Length:366
Mass (Da):39,846
Checksum:iE7202AB9FFD0772B
GO
Isoform MS16 (identifier: P19339-5) [UniParc]FASTAAdd to basket
Also known as: P

The sequence of this isoform differs from the canonical sequence as follows:
     333-354: RSIKSQQRFQNSHPYFDAKKFI → ENFADLLDGLYRRKYHYPYL

Show »
Length:352
Mass (Da):38,370
Checksum:i30528D103AEA1523
GO
Isoform O (identifier: P19339-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MYGNNNPGSNNNNGGYPPYGYNNKS → MDFNFDTVTPCSTMSSYYNFKMA
     42-49: Missing.
     332-354: GRSIKSQQRFQNSHPYFDAKKFI → DGAMEKLRSLFDAICDAIFGLDSENFADLLDGLYRRKYHYPYL

Show »
Length:364
Mass (Da):39,839
Checksum:i180D2C7B3316D85D
GO
Isoform R (identifier: P19339-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MYGNNNPGSNNNNGGYPPYGYNNKS → MDFNFDTVTPCSTMSSYYNFKMA
     42-49: Missing.
     333-354: RSIKSQQRFQNSHPYFDAKKFI → ENFADLLDGLYRRKYHYPYL

Show »
Length:342
Mass (Da):37,426
Checksum:iAABC024FFCF99F76
GO
Isoform S (identifier: P19339-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.

Show »
Length:322
Mass (Da):35,241
Checksum:i54C3A1F020F451FF
GO
Isoform V (identifier: P19339-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MYGNNNPGSNNNNGGYPPYGYNNKS → MDFNFDTVTPCSTMSSYYNFKMARNGIDSSY

Show »
Length:360
Mass (Da):39,435
Checksum:iA56D6D64FB33528B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M9PHB3M9PHB3_DROME
Sex lethal, isoform Y
Sxl CG14425, CG18350, CG33070, Dmel\CG43770, DmSxl
708Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PGK6M9PGK6_DROME
Sex lethal, isoform X
Sxl CG14425, CG18350, CG33070, Dmel\CG43770, DmSxl
722Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PGW6M9PGW6_DROME
Sex lethal, isoform Z
Sxl CG14425, CG18350, CG33070, Dmel\CG43770, DmSxl
42Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PJB1M9PJB1_DROME
Sex lethal, isoform AA
Sxl CG14425, CG18350, CG33070, Dmel\CG43770, DmSxl
48Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti93P → S in AAA28921 (PubMed:1710769).Curated1
Sequence conflicti96S → G in AAA28921 (PubMed:1710769).Curated1
Sequence conflicti96S → G in ACY56908 (Ref. 5) Curated1
Sequence conflicti96S → G in ADD20766 (Ref. 5) Curated1
Sequence conflicti273N → K in ACY56908 (Ref. 5) Curated1
Isoform 1 (identifier: P19339-2)
Sequence conflicti15S → C in AAB21845 (PubMed:1547493).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0192871 – 32Missing in isoform A and isoform S. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0058811 – 25MYGNN…YNNKS → MDFNFDTVTPCSTMSSYYNF KMA in isoform 1, isoform C, isoform O and isoform R. CuratedAdd BLAST25
Alternative sequenceiVSP_0405261 – 25MYGNN…YNNKS → MDFNFDTVTPCSTMSSYYNF KMARNGIDSSY in isoform V. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_00588226 – 48SGGRG…YAFSP → RHIFFHSPERSSHHYHRKAK DTH in isoform CM1. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_01928927 – 42GGRGF…PSGMS → PERSSHHYHRKAKDTH in isoform K. CuratedAdd BLAST16
Alternative sequenceiVSP_00588342 – 49Missing in isoform A, isoform C, isoform G, isoform W, isoform MS11, isoform O and isoform R. 2 Publications8
Alternative sequenceiVSP_01929043 – 354Missing in isoform K. CuratedAdd BLAST312
Alternative sequenceiVSP_00588449 – 354Missing in isoform CM1. 1 PublicationAdd BLAST306
Alternative sequenceiVSP_005885332 – 354GRSIK…AKKFI → DGAMEKLRSLFDAICDAIFG LDSENFADLLDGLYRRKYHY PYL in isoform MS11 and isoform O. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_005886333 – 354RSIKS…AKKFI → ENFADLLDGLYRRKYHYPYL in isoform W, isoform MS16 and isoform R. 2 PublicationsAdd BLAST22

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M23635 mRNA Translation: AAA28885.1
M23636 mRNA Translation: AAA28884.1
M59447 mRNA Translation: AAA28922.1
M59448 mRNA Translation: AAA28921.1
AE014298 Genomic DNA Translation: AAF46240.2
AE014298 Genomic DNA Translation: AAF46241.4
AE014298 Genomic DNA Translation: AAG22410.1
AE014298 Genomic DNA Translation: AAG22411.1
AE014298 Genomic DNA Translation: AAN09197.1
AE014298 Genomic DNA Translation: AAN09198.1
AE014298 Genomic DNA Translation: AAN09200.2
AE014298 Genomic DNA Translation: AAN09201.2
AE014298 Genomic DNA Translation: AAO41638.2
AE014298 Genomic DNA Translation: AAZ52509.1
AE014298 Genomic DNA Translation: AAZ52510.1
AE014298 Genomic DNA Translation: AAZ52511.1
AE014298 Genomic DNA Translation: AAZ52512.1
AE014298 Genomic DNA Translation: AAZ52513.1
AE014298 Genomic DNA Translation: AAZ52514.1
AE014298 Genomic DNA Translation: ACZ95222.1
AE014298 Genomic DNA Translation: ACZ95223.1
AE014298 Genomic DNA Translation: ACZ95224.1
AE014298 Genomic DNA Translation: ACZ95225.1
AE014298 Genomic DNA Translation: ACZ95226.1
BT003583 mRNA Translation: AAO39587.1
BT099922 mRNA Translation: ACX32993.1
BT100240 mRNA Translation: ACY56908.1
BT120392 mRNA Translation: ADD20766.1
S88324 Genomic DNA Translation: AAB21845.1
D84425 Genomic DNA Translation: BAA20294.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A31639
A39725 B31639

NCBI Reference Sequences

More...
RefSeqi
NP_001027062.1, NM_001031891.3 [P19339-6]
NP_001027063.1, NM_001031892.2 [P19339-8]
NP_001027064.1, NM_001031893.2 [P19339-3]
NP_001027065.1, NM_001031894.1 [P19339-1]
NP_001027066.1, NM_001031895.1 [P19339-11]
NP_001162686.1, NM_001169215.2 [P19339-5]
NP_001162687.1, NM_001169216.2 [P19339-11]
NP_001162688.1, NM_001169217.2 [P19339-12]
NP_001162689.1, NM_001169218.3 [P19339-13]
NP_001162690.1, NM_001169219.1 [P19339-1]
NP_001259305.1, NM_001272376.1 [P19339-11]
NP_001259306.1, NM_001272377.1 [P19339-3]
NP_524791.3, NM_080052.4 [P19339-8]
NP_727160.2, NM_167110.3 [P19339-7]
NP_727161.3, NM_167111.3 [P19339-9]
NP_727162.2, NM_167112.2 [P19339-1]
NP_727163.2, NM_167113.3 [P19339-10]
NP_727164.2, NM_167114.2 [P19339-4]
NP_727165.2, NM_167115.3 [P19339-10]
NP_727166.2, NM_167116.2 [P19339-7]
NP_727167.2, NM_167117.2 [P19339-3]
NP_727168.1, NM_167118.2 [P19339-3]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0331247; FBpp0303689; FBgn0264270 [P19339-9]
FBtr0331249; FBpp0303691; FBgn0264270 [P19339-3]
FBtr0331250; FBpp0303692; FBgn0264270 [P19339-7]
FBtr0331251; FBpp0303693; FBgn0264270 [P19339-4]
FBtr0331253; FBpp0303695; FBgn0264270 [P19339-7]
FBtr0331254; FBpp0303696; FBgn0264270 [P19339-11]
FBtr0331255; FBpp0303697; FBgn0264270 [P19339-1]
FBtr0331256; FBpp0303698; FBgn0264270 [P19339-3]
FBtr0331257; FBpp0303699; FBgn0264270 [P19339-8]
FBtr0331258; FBpp0303700; FBgn0264270 [P19339-6]
FBtr0331259; FBpp0303701; FBgn0264270 [P19339-10]
FBtr0331260; FBpp0303702; FBgn0264270 [P19339-3]
FBtr0331261; FBpp0303703; FBgn0264270 [P19339-8]
FBtr0331262; FBpp0303704; FBgn0264270 [P19339-1]
FBtr0331263; FBpp0303705; FBgn0264270 [P19339-10]
FBtr0331264; FBpp0303706; FBgn0264270 [P19339-5]
FBtr0331265; FBpp0303707; FBgn0264270 [P19339-11]
FBtr0331266; FBpp0303708; FBgn0264270 [P19339-12]
FBtr0331268; FBpp0303710; FBgn0264270 [P19339-1]
FBtr0336727; FBpp0307708; FBgn0264270 [P19339-11]
FBtr0336728; FBpp0307709; FBgn0264270 [P19339-3]
FBtr0336729; FBpp0307710; FBgn0264270 [P19339-13]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3772180

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG43770

UCSC genome browser

More...
UCSCi
CG18350-RE d. melanogaster
CG18350-RF d. melanogaster
CG18350-RL d. melanogaster
CG18350-RN d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M23635 mRNA Translation: AAA28885.1
M23636 mRNA Translation: AAA28884.1
M59447 mRNA Translation: AAA28922.1
M59448 mRNA Translation: AAA28921.1
AE014298 Genomic DNA Translation: AAF46240.2
AE014298 Genomic DNA Translation: AAF46241.4
AE014298 Genomic DNA Translation: AAG22410.1
AE014298 Genomic DNA Translation: AAG22411.1
AE014298 Genomic DNA Translation: AAN09197.1
AE014298 Genomic DNA Translation: AAN09198.1
AE014298 Genomic DNA Translation: AAN09200.2
AE014298 Genomic DNA Translation: AAN09201.2
AE014298 Genomic DNA Translation: AAO41638.2
AE014298 Genomic DNA Translation: AAZ52509.1
AE014298 Genomic DNA Translation: AAZ52510.1
AE014298 Genomic DNA Translation: AAZ52511.1
AE014298 Genomic DNA Translation: AAZ52512.1
AE014298 Genomic DNA Translation: AAZ52513.1
AE014298 Genomic DNA Translation: AAZ52514.1
AE014298 Genomic DNA Translation: ACZ95222.1
AE014298 Genomic DNA Translation: ACZ95223.1
AE014298 Genomic DNA Translation: ACZ95224.1
AE014298 Genomic DNA Translation: ACZ95225.1
AE014298 Genomic DNA Translation: ACZ95226.1
BT003583 mRNA Translation: AAO39587.1
BT099922 mRNA Translation: ACX32993.1
BT100240 mRNA Translation: ACY56908.1
BT120392 mRNA Translation: ADD20766.1
S88324 Genomic DNA Translation: AAB21845.1
D84425 Genomic DNA Translation: BAA20294.1
PIRiA31639
A39725 B31639
RefSeqiNP_001027062.1, NM_001031891.3 [P19339-6]
NP_001027063.1, NM_001031892.2 [P19339-8]
NP_001027064.1, NM_001031893.2 [P19339-3]
NP_001027065.1, NM_001031894.1 [P19339-1]
NP_001027066.1, NM_001031895.1 [P19339-11]
NP_001162686.1, NM_001169215.2 [P19339-5]
NP_001162687.1, NM_001169216.2 [P19339-11]
NP_001162688.1, NM_001169217.2 [P19339-12]
NP_001162689.1, NM_001169218.3 [P19339-13]
NP_001162690.1, NM_001169219.1 [P19339-1]
NP_001259305.1, NM_001272376.1 [P19339-11]
NP_001259306.1, NM_001272377.1 [P19339-3]
NP_524791.3, NM_080052.4 [P19339-8]
NP_727160.2, NM_167110.3 [P19339-7]
NP_727161.3, NM_167111.3 [P19339-9]
NP_727162.2, NM_167112.2 [P19339-1]
NP_727163.2, NM_167113.3 [P19339-10]
NP_727164.2, NM_167114.2 [P19339-4]
NP_727165.2, NM_167115.3 [P19339-10]
NP_727166.2, NM_167116.2 [P19339-7]
NP_727167.2, NM_167117.2 [P19339-3]
NP_727168.1, NM_167118.2 [P19339-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1B7FX-ray2.60A/B122-289[»]
1SXLNMR-A199-294[»]
2SXLNMR-A122-209[»]
3SXLX-ray2.70A/B/C111-294[»]
4QQBX-ray2.80A/B122-294[»]
SMRiP19339
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi533777, 111 interactors
DIPiDIP-44607N
IntActiP19339, 9 interactors
MINTiP19339
STRINGi7227.FBpp0303693

Proteomic databases

PaxDbiP19339
PRIDEiP19339

Genome annotation databases

EnsemblMetazoaiFBtr0331247; FBpp0303689; FBgn0264270 [P19339-9]
FBtr0331249; FBpp0303691; FBgn0264270 [P19339-3]
FBtr0331250; FBpp0303692; FBgn0264270 [P19339-7]
FBtr0331251; FBpp0303693; FBgn0264270 [P19339-4]
FBtr0331253; FBpp0303695; FBgn0264270 [P19339-7]
FBtr0331254; FBpp0303696; FBgn0264270 [P19339-11]
FBtr0331255; FBpp0303697; FBgn0264270 [P19339-1]
FBtr0331256; FBpp0303698; FBgn0264270 [P19339-3]
FBtr0331257; FBpp0303699; FBgn0264270 [P19339-8]
FBtr0331258; FBpp0303700; FBgn0264270 [P19339-6]
FBtr0331259; FBpp0303701; FBgn0264270 [P19339-10]
FBtr0331260; FBpp0303702; FBgn0264270 [P19339-3]
FBtr0331261; FBpp0303703; FBgn0264270 [P19339-8]
FBtr0331262; FBpp0303704; FBgn0264270 [P19339-1]
FBtr0331263; FBpp0303705; FBgn0264270 [P19339-10]
FBtr0331264; FBpp0303706; FBgn0264270 [P19339-5]
FBtr0331265; FBpp0303707; FBgn0264270 [P19339-11]
FBtr0331266; FBpp0303708; FBgn0264270 [P19339-12]
FBtr0331268; FBpp0303710; FBgn0264270 [P19339-1]
FBtr0336727; FBpp0307708; FBgn0264270 [P19339-11]
FBtr0336728; FBpp0307709; FBgn0264270 [P19339-3]
FBtr0336729; FBpp0307710; FBgn0264270 [P19339-13]
GeneIDi3772180
KEGGidme:Dmel_CG43770
UCSCiCG18350-RE d. melanogaster
CG18350-RF d. melanogaster
CG18350-RL d. melanogaster
CG18350-RN d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3772180
FlyBaseiFBgn0264270 Sxl

Phylogenomic databases

eggNOGiENOG410IQXB Eukaryota
ENOG411112S LUCA
InParanoidiP19339
KOiK18747
PhylomeDBiP19339

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Sxl fly
EvolutionaryTraceiP19339

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3772180

Protein Ontology

More...
PROi
PR:P19339

Gene expression databases

BgeeiFBgn0264270 Expressed in 29 organ(s), highest expression level in embryo
ExpressionAtlasiP19339 baseline and differential
GenevisibleiP19339 DM

Family and domain databases

DisProtiDP01605
Gene3Di3.30.70.330, 2 hits
InterProiView protein in InterPro
IPR002343 Hud_Sxl_RNA
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
IPR006546 Sxl
PfamiView protein in Pfam
PF00076 RRM_1, 2 hits
PRINTSiPR00961 HUDSXLRNA
SMARTiView protein in SMART
SM00360 RRM, 2 hits
SUPFAMiSSF54928 SSF54928, 1 hit
TIGRFAMsiTIGR01659 sex-lethal, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSXL_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P19339
Secondary accession number(s): A4V434
, A4V435, A4V436, A4V437, C9QP40, D0IQK2, D3PFI6, E1JJI8, E1JJI9, E1JJJ0, E1JJJ2, E1JJJ3, P19340, Q0KHV2, Q26466, Q2MGN7, Q2MGN8, Q2MGN9, Q2MGP1, Q7KVU6, Q7YZ92, Q8IRQ1, Q99141, Q9TYF5, Q9W3S6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1990
Last sequence update: November 1, 1990
Last modified: December 11, 2019
This is version 204 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again