ATF3

Functionⁱ

This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.

GO - Molecular functionⁱ

DNA-binding transcription activator activity, RNA polymerase II-specific Source: NTNU_SB
DNA-binding transcription factor activity
Source: ParkinsonsUK-UCL
Inferred from genetic interactionⁱ
- 24939851
DNA-binding transcription factor activity, RNA polymerase II-specific Source: NTNU_SB
identical protein binding
Source: IntAct
Inferred from physical interactionⁱ
- 18255255
protein heterodimerization activity
Source: ParkinsonsUK-UCL
Inferred from physical interactionⁱ
- 8622660
protein homodimerization activity
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 8622660
proximal promoter DNA-binding transcription repressor activity, RNA polymerase II-specific Source: Ensembl
RNA polymerase II proximal promoter sequence-specific DNA binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
RNA polymerase II regulatory region sequence-specific DNA binding
Source: NTNU_SB
Inferred from direct assayⁱ
- 2516827
transcription corepressor activity
Source: ProtInc
Traceable author statementⁱ
- 7515060
transcription regulatory region DNA binding
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 8622660
transcription regulatory region sequence-specific DNA binding
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 24939851

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cellular response to amino acid starvation Source: Ensembl
gluconeogenesis Source: Ensembl
negative regulation of ERK1 and ERK2 cascade Source: Ensembl
negative regulation of transcription by RNA polymerase II
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 8622660
PERK-mediated unfolded protein response Source: Reactome
positive regulation of cell proliferation Source: Ensembl
positive regulation of TRAIL-activated apoptotic signaling pathway
Source: ParkinsonsUK-UCL
Inferred from mutant phenotypeⁱ
- 24939851
positive regulation of transcription by RNA polymerase II
Source: NTNU_SB
Inferred from direct assayⁱ
- 16300731
positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 24939851
regulation of transcription from RNA polymerase II promoter in response to arsenic-containing substance
Source: ParkinsonsUK-UCL
Traceable author statementⁱ
- 14685163
skeletal muscle cell differentiation Source: Ensembl

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	DNA-binding, Repressor
Biological process	Transcription, Transcription regulation

Enzyme and pathway databases

Reactomeⁱ	R-HSA-380994 ATF4 activates genes
SignaLinkⁱ	P18847
SIGNORⁱ	P18847

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Cyclic AMP-dependent transcription factor ATF-3 Short name: cAMP-dependent transcription factor ATF-3 Alternative name(s): Activating transcription factor 3
Gene namesⁱ	Name:ATF3
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 1

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000162772.16
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:785 ATF3
MIMⁱ	603148 gene
neXtProtⁱ	NX_P18847

Keywords - Cellular componentⁱ

Nucleus

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	467
Open Targets More...OpenTargetsⁱ	ENSG00000162772
PharmGKBⁱ	PA25085

Chemistry databases

Drug and drug target database More...DrugBankⁱ	DB00852 Pseudoephedrine

DrugBankⁱ

DB00852 Pseudoephedrine

Polymorphism and mutation databases

BioMutaⁱ	ATF3
DMDMⁱ	1168543

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000076581	1 – 181	Cyclic AMP-dependent transcription factor ATF-3Add BLAST		181

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Cross-linkⁱ	78	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residueⁱ	162	PhosphothreonineCombined sources	1
Cross-linkⁱ	175	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMⁱ

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDⁱ	P18847
PaxDbⁱ	P18847
PeptideAtlas More...PeptideAtlasⁱ	P18847
PRIDEⁱ	P18847
ProteomicsDBⁱ	53611 53612 [P18847-2] 53613 [P18847-3] 53614 [P18847-4]
TopDownProteomicsⁱ	P18847-1 [P18847-1]

PTM databases

iPTMnetⁱ	P18847
PhosphoSitePlusⁱ	P18847

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000162772 Expressed in 227 organ(s), highest expression level in vena cava
CleanExⁱ	HS_ATF3
ExpressionAtlasⁱ	P18847 baseline and differential
Genevisibleⁱ	P18847 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA001562

HPAⁱ

HPA001562

Interactionⁱ

Subunit structureⁱ

Binds DNA as a homodimer or a heterodimer.

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
itself		2	EBI-712767,EBI-712767
ATF2	P15336	2	EBI-712767,EBI-1170906
ATF4	P18848	7	EBI-712767,EBI-492498
ATF7	P17544	2	EBI-712767,EBI-765623
BATF3	Q9NR55	2	EBI-712767,EBI-10312707
CEBPG	P53567	2	EBI-712767,EBI-740209
DDIT3	P35638	4	EBI-712767,EBI-742651
FHL2	Q14192	3	EBI-712767,EBI-701903
JUN	P05412	7	EBI-712767,EBI-852823
JUNB	P17275	2	EBI-712767,EBI-748062
JUND	P17535	2	EBI-712767,EBI-2682803
NFATC1	O95644	2	EBI-712767,EBI-6907210
RELA	Q04206	5	EBI-9844134,EBI-73886

GO - Molecular functionⁱ

identical protein binding
Source: IntAct
Inferred from physical interactionⁱ
- 18255255
protein heterodimerization activity
Source: ParkinsonsUK-UCL
Inferred from physical interactionⁱ
- 8622660
protein homodimerization activity
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 8622660

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	106957, 63 interactors
CORUMⁱ	P18847
Database of interacting proteins More...DIPⁱ	DIP-344N
IntActⁱ	P18847, 35 interactors
Molecular INTeraction database More...MINTⁱ	P18847
STRINGⁱ	9606.ENSP00000344352

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	P18847
SMRⁱ	P18847
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	86 – 149	bZIPPROSITE-ProRule annotationAdd BLAST		64

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	88 – 110	Basic motifPROSITE-ProRule annotationAdd BLAST		23
Regionⁱ	114 – 142	Leucine-zipperPROSITE-ProRule annotationAdd BLAST		29

Sequence similaritiesⁱ

Belongs to the bZIP family. ATF subfamily.Curated

Phylogenomic databases

eggNOGⁱ	KOG1414 Eukaryota ENOG4111CH5 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00730000110847
HOGENOMⁱ	HOG000034126
HOVERGENⁱ	HBG003381
InParanoidⁱ	P18847
KEGG Orthology (KO) More...KOⁱ	K09032
OMAⁱ	LVYMLNL
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0M4N
PhylomeDBⁱ	P18847
TreeFamⁱ	TF326301

Family and domain databases

InterProⁱ	View protein in InterPro IPR000837 AP-1 IPR029812 ATF3 IPR004827 bZIP
PANTHERⁱ	PTHR23351 PTHR23351, 1 hit PTHR23351:SF23 PTHR23351:SF23, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00170 bZIP_1, 1 hit
PRINTSⁱ	PR00042 LEUZIPPRFOS
SMARTⁱ	View protein in SMART SM00338 BRLZ, 1 hit
PROSITEⁱ	View protein in PROSITE PS50217 BZIP, 1 hit PS00036 BZIP_BASIC, 1 hit

Sequences (5+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 5 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show all Align All

Isoform 1 (identifier: P18847-1) [UniParc]FASTA Add to basket

Also known as: ATF3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMLQHPGQVS ASEVSASAIV PCLSPPGSLV FEDFANLTPF VKEELRFAIQ 
        60         70         80         90        100
NKHLCHRMSS ALESVTVSDR PLGVSITKAE VAPEEDERKK RRRERNKIAA 
       110        120        130        140        150
AKCRNKKKEK TECLQKESEK LESVNAELKA QIEELKNEKQ HLIYMLNLHR 
       160        170        180 
PTCIVRAQNG RTPEDERNLF IQQIKEGTLQ S

Length:181

Mass (Da):20,576

Last modified:November 1, 1995 - v2

Checksum:ⁱEC5D8F065EEE2D9C

GO

Isoform 2 (identifier: P18847-2) [UniParc]FASTA Add to basket

Also known as: ATF3-delta-Zip

The sequence of this isoform differs from the canonical sequence as follows:
116-181: KESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS → LQY

« Hide

        10         20         30         40         50
MMLQHPGQVS ASEVSASAIV PCLSPPGSLV FEDFANLTPF VKEELRFAIQ 
        60         70         80         90        100
NKHLCHRMSS ALESVTVSDR PLGVSITKAE VAPEEDERKK RRRERNKIAA 
       110 
AKCRNKKKEK TECLQLQY

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »

Length:118

Mass (Da):13,266

Checksum:ⁱE0444ABC236FA838

GO

Isoform 3 (identifier: P18847-3) [UniParc]FASTA Add to basket

Also known as: ATF3-delta-Zip2a/TF3-delta-Zip2b

The sequence of this isoform differs from the canonical sequence as follows:
117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK

« Hide

        10         20         30         40         50
MMLQHPGQVS ASEVSASAIV PCLSPPGSLV FEDFANLTPF VKEELRFAIQ 
        60         70         80         90        100
NKHLCHRMSS ALESVTVSDR PLGVSITKAE VAPEEDERKK RRRERNKIAA 
       110        120        130 
AKCRNKKKEK TECLQKLPRP FWVQKTCIWA VDSCK

Note: Stress-induced isoform, counteracts the transcriptional repression of isoform 1.

Show »

Length:135

Mass (Da):15,250

Checksum:ⁱ4A7AB87BE6374478

GO

Isoform 4 (identifier: P18847-4) [UniParc]FASTA Add to basket

Also known as: ATF3-delta-Zip2c

The sequence of this isoform differs from the canonical sequence as follows:
14-42: Missing.
117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK

« Hide

        10         20         30         40         50
MMLQHPGQVS ASEEELRFAI QNKHLCHRMS SALESVTVSD RPLGVSITKA 
        60         70         80         90        100
EVAPEEDERK KRRRERNKIA AAKCRNKKKE KTECLQKLPR PFWVQKTCIW 

AVDSCK

Show »

Length:106

Mass (Da):12,261

Checksum:ⁱC0BE4D381ECB1833

GO

Isoform 5 (identifier: P18847-5) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
1-57: Missing.

« Hide

        10         20         30         40         50
MSSALESVTV SDRPLGVSIT KAEVAPEEDE RKKRRRERNK IAAAKCRNKK 
        60         70         80         90        100
KEKTECLQKE SEKLESVNAE LKAQIEELKN EKQHLIYMLN LHRPTCIVRA 
       110        120 
QNGRTPEDER NLFIQQIKEG TLQS

Show »

Length:124

Mass (Da):14,314

Checksum:ⁱ71BF35DFB32B5625

GO

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

Q5VTZ4	Q5VTZ4_HUMAN	Cyclic AMP-dependent transcription ... Cyclic AMP-dependent transcription factor ATF-3	ATF3	175	Annotation score:
A0A0A0MRJ2	A0A0A0MRJ2_HUMAN	Cyclic AMP-dependent transcription ... Cyclic AMP-dependent transcription factor ATF-3	ATF3	153	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	132	I → L no nucleotide entry (PubMed:2516827).Curated		1

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_048442	38	T → M1 PublicationCorresponds to variant dbSNP:rs11571541Ensembl.		1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Length
Alternative sequenceⁱVSP_046966	1 – 57	Missing in isoform 5. 1 PublicationAdd BLAST	57
Alternative sequenceⁱVSP_043182	14 – 42	Missing in isoform 4. 1 PublicationAdd BLAST	29
Alternative sequenceⁱVSP_000592	116 – 181	KESEK…GTLQS → LQY in isoform 2. 1 PublicationAdd BLAST	66
Alternative sequenceⁱVSP_043150	117 – 181	ESEKL…GTLQS → LPRPFWVQKTCIWAVDSCK in isoform 3 and isoform 4. 2 PublicationsAdd BLAST	65

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L19871 mRNA Translation: AAA20506.1 AB066566 mRNA Translation: BAB84092.1 AB078026 mRNA Translation: BAC00495.1 AB078027 mRNA Translation: BAC00496.1 AY313927 mRNA Translation: AAP93896.1 BT006996 mRNA Translation: AAP35642.1 AY426987 Genomic DNA Translation: AAQ93358.1 AK312998 mRNA Translation: BAG35834.1 DA589280 mRNA No translation available. CR450334 mRNA Translation: CAG29330.1 AC092803 Genomic DNA No translation available. AL590648 Genomic DNA No translation available. AL606913 Genomic DNA No translation available. CH471100 Genomic DNA Translation: EAW93385.1 CH471100 Genomic DNA Translation: EAW93386.1 CH471100 Genomic DNA Translation: EAW93387.1 CH471100 Genomic DNA Translation: EAW93388.1 BC006322 mRNA Translation: AAH06322.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS1506.1 [P18847-1] CCDS41464.1 [P18847-3] CCDS55688.1 [P18847-4] CCDS58059.1 [P18847-5]
PIRⁱ	A54025 B54025 C34223
NCBI Reference Sequences More...RefSeqⁱ	NP_001025458.1, NM_001030287.3 [P18847-1] NP_001035709.1, NM_001040619.2 [P18847-3] NP_001193413.2, NM_001206484.2 [P18847-5] NP_001193415.1, NM_001206486.2 [P18847-4] NP_001193417.2, NM_001206488.2 [P18847-5] NP_001665.1, NM_001674.3 [P18847-1] XP_005273203.1, XM_005273146.1 [P18847-1] XP_011507881.1, XM_011509579.1 [P18847-1]
UniGeneⁱ	Hs.460

Genome annotation databases

Keywords - Coding sequence diversityⁱ

Alternative splicing, Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P18847	ATF3 isoform 2		PANTR		181	UniRef100_P18847
Uncharacterized protein		AOTNA		181
Uncharacterized protein		NOMLE		181
Activating transcription factor 3		GORGO		181
Cyclic AMP-dependent transcription factor ATF-3 (Fragment)		HUMAN		175
+3
P18847-4	Uncharacterized protein		NOMLE		106	UniRef100_A0A2I3I004
Activating transcription factor 3		GORGO		106

Protein	Similar proteins		Species	Score	Length	Source
P18847	Cyclic AMP-dependent transcription factor ATF-3		MOUSE		181	UniRef90_P18847
Cyclic AMP-dependent transcription factor ATF-3		RAT		181
ATF3 isoform 2		PANTR		181
Uncharacterized protein		AOTNA		181
Uncharacterized protein		NOMLE		181
+87
P18847-2	Isoform 3 of Cyclic AMP-dependent transcription factor ATF-3		HUMAN		135	UniRef90_P18847-3
Activating transcription factor 3		CALJA		136
Uncharacterized protein		FELCA		136
ATF3 isoform 7		PANTR		135
ATF3 isoform 7		PONAB		135
+16
P18847-3	Activating transcription factor 3		CALJA		136	UniRef90_P18847-3
Uncharacterized protein		FELCA		136
ATF3 isoform 7		PANTR		135
ATF3 isoform 7		PONAB		135
Uncharacterized protein		CERAT		135
+16
P18847-4	ATF3 isoform 10		PANTR		106	UniRef90_A0A2I3SM27
Activating transcription factor 3		CALJA		107
Activating transcription factor 3		SAIBB		106
Uncharacterized protein		COLAP		106
Uncharacterized protein		Cebus capucinus imitator		106
+12

Protein	Similar proteins		Species	Score	Length	Source
P18847	Cyclic AMP-dependent transcription factor ATF-3		MOUSE		181	UniRef50_P18847
Cyclic AMP-dependent transcription factor ATF-3		RAT		181
ATF3 isoform 2		PANTR		181
Uncharacterized protein		AOTNA		181
Uncharacterized protein		NOMLE		181
+158
P18847-2	Isoform 3 of Cyclic AMP-dependent transcription factor ATF-3		HUMAN		135	UniRef50_P18847-3
Uncharacterized protein		FELCA		136
Activating transcription factor 3		CALJA		136
Uncharacterized protein		RHIRO		135
Uncharacterized protein		RHIBE		135
+28
P18847-3	Uncharacterized protein		FELCA		136	UniRef50_P18847-3
Activating transcription factor 3		CALJA		136
Uncharacterized protein		RHIRO		135
Uncharacterized protein		RHIBE		135
Uncharacterized protein		MANLE		135
+28
P18847-4	Uncharacterized protein		MACMU		108	UniRef50_F7HTS2
Uncharacterized protein		FELCA		107
Uncharacterized protein		PROCO		100
Uncharacterized protein		AOTNA		106
Activating transcription factor 3		CALJA		107
+15

Cross-referencesⁱ

Web resourcesⁱ

NIEHS-SNPs

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L19871 mRNA Translation: AAA20506.1 AB066566 mRNA Translation: BAB84092.1 AB078026 mRNA Translation: BAC00495.1 AB078027 mRNA Translation: BAC00496.1 AY313927 mRNA Translation: AAP93896.1 BT006996 mRNA Translation: AAP35642.1 AY426987 Genomic DNA Translation: AAQ93358.1 AK312998 mRNA Translation: BAG35834.1 DA589280 mRNA No translation available. CR450334 mRNA Translation: CAG29330.1 AC092803 Genomic DNA No translation available. AL590648 Genomic DNA No translation available. AL606913 Genomic DNA No translation available. CH471100 Genomic DNA Translation: EAW93385.1 CH471100 Genomic DNA Translation: EAW93386.1 CH471100 Genomic DNA Translation: EAW93387.1 CH471100 Genomic DNA Translation: EAW93388.1 BC006322 mRNA Translation: AAH06322.1
CCDSⁱ	CCDS1506.1 [P18847-1] CCDS41464.1 [P18847-3] CCDS55688.1 [P18847-4] CCDS58059.1 [P18847-5]
PIRⁱ	A54025 B54025 C34223
RefSeqⁱ	NP_001025458.1, NM_001030287.3 [P18847-1] NP_001035709.1, NM_001040619.2 [P18847-3] NP_001193413.2, NM_001206484.2 [P18847-5] NP_001193415.1, NM_001206486.2 [P18847-4] NP_001193417.2, NM_001206488.2 [P18847-5] NP_001665.1, NM_001674.3 [P18847-1] XP_005273203.1, XM_005273146.1 [P18847-1] XP_011507881.1, XM_011509579.1 [P18847-1]
UniGeneⁱ	Hs.460

3D structure databases

ProteinModelPortalⁱ	P18847
SMRⁱ	P18847
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	106957, 63 interactors
CORUMⁱ	P18847
DIPⁱ	DIP-344N
IntActⁱ	P18847, 35 interactors
MINTⁱ	P18847
STRINGⁱ	9606.ENSP00000344352

Chemistry databases

DrugBankⁱ	DB00852 Pseudoephedrine

DrugBankⁱ

DB00852 Pseudoephedrine

PTM databases

iPTMnetⁱ	P18847
PhosphoSitePlusⁱ	P18847

Polymorphism and mutation databases

BioMutaⁱ	ATF3
DMDMⁱ	1168543

Proteomic databases

EPDⁱ	P18847
PaxDbⁱ	P18847
PeptideAtlasⁱ	P18847
PRIDEⁱ	P18847
ProteomicsDBⁱ	53611 53612 [P18847-2] 53613 [P18847-3] 53614 [P18847-4]
TopDownProteomicsⁱ	P18847-1 [P18847-1]

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	467
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000336937; ENSP00000336908; ENSG00000162772 [P18847-4] ENST00000341491; ENSP00000344352; ENSG00000162772 [P18847-1] ENST00000366983; ENSP00000355950; ENSG00000162772 [P18847-3] ENST00000366987; ENSP00000355954; ENSG00000162772 [P18847-1] ENST00000464547; ENSP00000432208; ENSG00000162772 [P18847-3] ENST00000613104; ENSP00000480606; ENSG00000162772 [P18847-5] ENST00000613954; ENSP00000483576; ENSG00000162772 [P18847-5]
GeneIDⁱ	467
KEGGⁱ	hsa:467
UCSCⁱ	uc001hjf.4 human [P18847-1]

Organism-specific databases

CTDⁱ	467
DisGeNETⁱ	467
EuPathDBⁱ	HostDB:ENSG00000162772.16
GeneCardsⁱ	ATF3
HGNCⁱ	HGNC:785 ATF3
HPAⁱ	HPA001562
MIMⁱ	603148 gene
neXtProtⁱ	NX_P18847
OpenTargetsⁱ	ENSG00000162772
PharmGKBⁱ	PA25085
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG1414 Eukaryota ENOG4111CH5 LUCA
GeneTreeⁱ	ENSGT00730000110847
HOGENOMⁱ	HOG000034126
HOVERGENⁱ	HBG003381
InParanoidⁱ	P18847
KOⁱ	K09032
OMAⁱ	LVYMLNL
OrthoDBⁱ	EOG091G0M4N
PhylomeDBⁱ	P18847
TreeFamⁱ	TF326301

Enzyme and pathway databases

Reactomeⁱ	R-HSA-380994 ATF4 activates genes
SignaLinkⁱ	P18847
SIGNORⁱ	P18847

Miscellaneous databases

ChiTaRSⁱ	ATF3 human
GeneWikiⁱ	ATF3
GenomeRNAiⁱ	467
Protein Ontology More...PROⁱ	PR:P18847
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000162772 Expressed in 227 organ(s), highest expression level in vena cava
CleanExⁱ	HS_ATF3
ExpressionAtlasⁱ	P18847 baseline and differential
Genevisibleⁱ	P18847 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR000837 AP-1 IPR029812 ATF3 IPR004827 bZIP
PANTHERⁱ	PTHR23351 PTHR23351, 1 hit PTHR23351:SF23 PTHR23351:SF23, 1 hit
Pfamⁱ	View protein in Pfam PF00170 bZIP_1, 1 hit
PRINTSⁱ	PR00042 LEUZIPPRFOS
SMARTⁱ	View protein in SMART SM00338 BRLZ, 1 hit
PROSITEⁱ	View protein in PROSITE PS50217 BZIP, 1 hit PS00036 BZIP_BASIC, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	ATF3_HUMAN
Accessionⁱ	P18847Primary (citable) accession number: P18847 Secondary accession number(s): Q5VTZ2 , Q6ICQ9, Q7Z566, Q8WYM6
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	November 1, 1990
	Last sequence update:	November 1, 1995
	Last modified:	November 7, 2018
	This is version 191 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 1
Human chromosome 1: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P18847 (ATF3_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Cyclic AMP-dependent transcription factor ATF-3

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Region

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Experimental Info

Natural variant

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ