Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 195 (08 May 2019)
Sequence version 2 (01 Nov 1995)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Cyclic AMP-dependent transcription factor ATF-3

Gene

ATF3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Repressor
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-380994 ATF4 activates genes in response to endoplasmic reticulum stress

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P18847

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P18847

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cyclic AMP-dependent transcription factor ATF-3
Short name:
cAMP-dependent transcription factor ATF-3
Alternative name(s):
Activating transcription factor 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ATF3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:785 ATF3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603148 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P18847

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
467

Open Targets

More...
OpenTargetsi
ENSG00000162772

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25085

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB00852 Pseudoephedrine

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ATF3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1168543

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000765811 – 181Cyclic AMP-dependent transcription factor ATF-3Add BLAST181

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki78Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei162PhosphothreonineCombined sources1
Cross-linki175Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P18847

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P18847

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P18847

PeptideAtlas

More...
PeptideAtlasi
P18847

PRoteomics IDEntifications database

More...
PRIDEi
P18847

ProteomicsDB human proteome resource

More...
ProteomicsDBi
53611
53612 [P18847-2]
53613 [P18847-3]
53614 [P18847-4]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P18847-1 [P18847-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P18847

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P18847

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000162772 Expressed in 227 organ(s), highest expression level in vena cava

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P18847 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P18847 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA001562

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds DNA as a homodimer or a heterodimer.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
106957, 65 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P18847

Database of interacting proteins

More...
DIPi
DIP-344N

Protein interaction database and analysis system

More...
IntActi
P18847, 42 interactors

Molecular INTeraction database

More...
MINTi
P18847

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000344352

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P18847

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini86 – 149bZIPPROSITE-ProRule annotationAdd BLAST64

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni88 – 110Basic motifPROSITE-ProRule annotationAdd BLAST23
Regioni114 – 142Leucine-zipperPROSITE-ProRule annotationAdd BLAST29

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the bZIP family. ATF subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1414 Eukaryota
ENOG4111CH5 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156376

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000034126

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P18847

KEGG Orthology (KO)

More...
KOi
K09032

Identification of Orthologs from Complete Genome Data

More...
OMAi
KQQLVYM

Database of Orthologous Groups

More...
OrthoDBi
1457971at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P18847

TreeFam database of animal gene trees

More...
TreeFami
TF326301

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000837 AP-1
IPR029812 ATF3
IPR004827 bZIP

The PANTHER Classification System

More...
PANTHERi
PTHR23351 PTHR23351, 1 hit
PTHR23351:SF23 PTHR23351:SF23, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00170 bZIP_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00042 LEUZIPPRFOS

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00338 BRLZ, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50217 BZIP, 1 hit
PS00036 BZIP_BASIC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P18847-1) [UniParc]FASTAAdd to basket
Also known as: ATF3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMLQHPGQVS ASEVSASAIV PCLSPPGSLV FEDFANLTPF VKEELRFAIQ
60 70 80 90 100
NKHLCHRMSS ALESVTVSDR PLGVSITKAE VAPEEDERKK RRRERNKIAA
110 120 130 140 150
AKCRNKKKEK TECLQKESEK LESVNAELKA QIEELKNEKQ HLIYMLNLHR
160 170 180
PTCIVRAQNG RTPEDERNLF IQQIKEGTLQ S
Length:181
Mass (Da):20,576
Last modified:November 1, 1995 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEC5D8F065EEE2D9C
GO
Isoform 2 (identifier: P18847-2) [UniParc]FASTAAdd to basket
Also known as: ATF3-delta-Zip

The sequence of this isoform differs from the canonical sequence as follows:
     116-181: KESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS → LQY

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:118
Mass (Da):13,266
Checksum:iE0444ABC236FA838
GO
Isoform 3 (identifier: P18847-3) [UniParc]FASTAAdd to basket
Also known as: ATF3-delta-Zip2a/TF3-delta-Zip2b

The sequence of this isoform differs from the canonical sequence as follows:
     117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK

Note: Stress-induced isoform, counteracts the transcriptional repression of isoform 1.
Show »
Length:135
Mass (Da):15,250
Checksum:i4A7AB87BE6374478
GO
Isoform 4 (identifier: P18847-4) [UniParc]FASTAAdd to basket
Also known as: ATF3-delta-Zip2c

The sequence of this isoform differs from the canonical sequence as follows:
     14-42: Missing.
     117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK

Show »
Length:106
Mass (Da):12,261
Checksum:iC0BE4D381ECB1833
GO
Isoform 5 (identifier: P18847-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: Missing.

Show »
Length:124
Mass (Da):14,314
Checksum:i71BF35DFB32B5625
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5VTZ4Q5VTZ4_HUMAN
Cyclic AMP-dependent transcription ...
ATF3
175Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MRJ2A0A0A0MRJ2_HUMAN
Cyclic AMP-dependent transcription ...
ATF3
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti132I → L no nucleotide entry (PubMed:2516827).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04844238T → M1 PublicationCorresponds to variant dbSNP:rs11571541Ensembl.1
Natural variantiVAR_081532168N → T De novo variant found in a patient with childhood apraxia of speech; unknown pathological significance. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0469661 – 57Missing in isoform 5. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_04318214 – 42Missing in isoform 4. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_000592116 – 181KESEK…GTLQS → LQY in isoform 2. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_043150117 – 181ESEKL…GTLQS → LPRPFWVQKTCIWAVDSCK in isoform 3 and isoform 4. 2 PublicationsAdd BLAST65

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L19871 mRNA Translation: AAA20506.1
AB066566 mRNA Translation: BAB84092.1
AB078026 mRNA Translation: BAC00495.1
AB078027 mRNA Translation: BAC00496.1
AY313927 mRNA Translation: AAP93896.1
BT006996 mRNA Translation: AAP35642.1
AY426987 Genomic DNA Translation: AAQ93358.1
AK312998 mRNA Translation: BAG35834.1
DA589280 mRNA No translation available.
CR450334 mRNA Translation: CAG29330.1
AC092803 Genomic DNA No translation available.
AL590648 Genomic DNA No translation available.
AL606913 Genomic DNA No translation available.
CH471100 Genomic DNA Translation: EAW93385.1
CH471100 Genomic DNA Translation: EAW93386.1
CH471100 Genomic DNA Translation: EAW93387.1
CH471100 Genomic DNA Translation: EAW93388.1
BC006322 mRNA Translation: AAH06322.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1506.1 [P18847-1]
CCDS41464.1 [P18847-3]
CCDS55688.1 [P18847-4]
CCDS58059.1 [P18847-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
A54025
B54025
C34223

NCBI Reference Sequences

More...
RefSeqi
NP_001025458.1, NM_001030287.3 [P18847-1]
NP_001035709.1, NM_001040619.2 [P18847-3]
NP_001193413.2, NM_001206484.2 [P18847-5]
NP_001193415.1, NM_001206486.2 [P18847-4]
NP_001193417.2, NM_001206488.2 [P18847-5]
NP_001665.1, NM_001674.3 [P18847-1]
XP_005273203.1, XM_005273146.1 [P18847-1]
XP_011507881.1, XM_011509579.1 [P18847-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000336937; ENSP00000336908; ENSG00000162772 [P18847-4]
ENST00000341491; ENSP00000344352; ENSG00000162772 [P18847-1]
ENST00000366983; ENSP00000355950; ENSG00000162772 [P18847-3]
ENST00000366987; ENSP00000355954; ENSG00000162772 [P18847-1]
ENST00000464547; ENSP00000432208; ENSG00000162772 [P18847-3]
ENST00000613104; ENSP00000480606; ENSG00000162772 [P18847-5]
ENST00000613954; ENSP00000483576; ENSG00000162772 [P18847-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
467

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:467

UCSC genome browser

More...
UCSCi
uc001hjf.4 human [P18847-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs
Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L19871 mRNA Translation: AAA20506.1
AB066566 mRNA Translation: BAB84092.1
AB078026 mRNA Translation: BAC00495.1
AB078027 mRNA Translation: BAC00496.1
AY313927 mRNA Translation: AAP93896.1
BT006996 mRNA Translation: AAP35642.1
AY426987 Genomic DNA Translation: AAQ93358.1
AK312998 mRNA Translation: BAG35834.1
DA589280 mRNA No translation available.
CR450334 mRNA Translation: CAG29330.1
AC092803 Genomic DNA No translation available.
AL590648 Genomic DNA No translation available.
AL606913 Genomic DNA No translation available.
CH471100 Genomic DNA Translation: EAW93385.1
CH471100 Genomic DNA Translation: EAW93386.1
CH471100 Genomic DNA Translation: EAW93387.1
CH471100 Genomic DNA Translation: EAW93388.1
BC006322 mRNA Translation: AAH06322.1
CCDSiCCDS1506.1 [P18847-1]
CCDS41464.1 [P18847-3]
CCDS55688.1 [P18847-4]
CCDS58059.1 [P18847-5]
PIRiA54025
B54025
C34223
RefSeqiNP_001025458.1, NM_001030287.3 [P18847-1]
NP_001035709.1, NM_001040619.2 [P18847-3]
NP_001193413.2, NM_001206484.2 [P18847-5]
NP_001193415.1, NM_001206486.2 [P18847-4]
NP_001193417.2, NM_001206488.2 [P18847-5]
NP_001665.1, NM_001674.3 [P18847-1]
XP_005273203.1, XM_005273146.1 [P18847-1]
XP_011507881.1, XM_011509579.1 [P18847-1]

3D structure databases

SMRiP18847
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106957, 65 interactors
CORUMiP18847
DIPiDIP-344N
IntActiP18847, 42 interactors
MINTiP18847
STRINGi9606.ENSP00000344352

Chemistry databases

DrugBankiDB00852 Pseudoephedrine

PTM databases

iPTMnetiP18847
PhosphoSitePlusiP18847

Polymorphism and mutation databases

BioMutaiATF3
DMDMi1168543

Proteomic databases

EPDiP18847
jPOSTiP18847
PaxDbiP18847
PeptideAtlasiP18847
PRIDEiP18847
ProteomicsDBi53611
53612 [P18847-2]
53613 [P18847-3]
53614 [P18847-4]
TopDownProteomicsiP18847-1 [P18847-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
467
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000336937; ENSP00000336908; ENSG00000162772 [P18847-4]
ENST00000341491; ENSP00000344352; ENSG00000162772 [P18847-1]
ENST00000366983; ENSP00000355950; ENSG00000162772 [P18847-3]
ENST00000366987; ENSP00000355954; ENSG00000162772 [P18847-1]
ENST00000464547; ENSP00000432208; ENSG00000162772 [P18847-3]
ENST00000613104; ENSP00000480606; ENSG00000162772 [P18847-5]
ENST00000613954; ENSP00000483576; ENSG00000162772 [P18847-5]
GeneIDi467
KEGGihsa:467
UCSCiuc001hjf.4 human [P18847-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
467
DisGeNETi467

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ATF3
HGNCiHGNC:785 ATF3
HPAiHPA001562
MIMi603148 gene
neXtProtiNX_P18847
OpenTargetsiENSG00000162772
PharmGKBiPA25085

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1414 Eukaryota
ENOG4111CH5 LUCA
GeneTreeiENSGT00940000156376
HOGENOMiHOG000034126
InParanoidiP18847
KOiK09032
OMAiKQQLVYM
OrthoDBi1457971at2759
PhylomeDBiP18847
TreeFamiTF326301

Enzyme and pathway databases

ReactomeiR-HSA-380994 ATF4 activates genes in response to endoplasmic reticulum stress
SignaLinkiP18847
SIGNORiP18847

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ATF3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ATF3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
467

Protein Ontology

More...
PROi
PR:P18847

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000162772 Expressed in 227 organ(s), highest expression level in vena cava
ExpressionAtlasiP18847 baseline and differential
GenevisibleiP18847 HS

Family and domain databases

InterProiView protein in InterPro
IPR000837 AP-1
IPR029812 ATF3
IPR004827 bZIP
PANTHERiPTHR23351 PTHR23351, 1 hit
PTHR23351:SF23 PTHR23351:SF23, 1 hit
PfamiView protein in Pfam
PF00170 bZIP_1, 1 hit
PRINTSiPR00042 LEUZIPPRFOS
SMARTiView protein in SMART
SM00338 BRLZ, 1 hit
PROSITEiView protein in PROSITE
PS50217 BZIP, 1 hit
PS00036 BZIP_BASIC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiATF3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P18847
Secondary accession number(s): Q5VTZ2
, Q6ICQ9, Q7Z566, Q8WYM6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1990
Last sequence update: November 1, 1995
Last modified: May 8, 2019
This is version 195 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again