Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 188 (29 Sep 2021)
Sequence version 5 (07 Oct 2020)
Previous versions | rss
Add a publicationFeedback
Protein

Triosephosphate isomerase

Gene

Tpi1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Triosephosphate isomerase is an extremely efficient metabolic enzyme that catalyzes the interconversion between dihydroxyacetone phosphate (DHAP) and D-glyceraldehyde-3-phosphate (G3P) in glycolysis and gluconeogenesis.

By similarity

It is also responsible for the non-negligible production of methylglyoxal a reactive cytotoxic side-product that modifies and can alter proteins, DNA and lipids.

By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: glycolysis

This protein is involved in step 1 of the subpathway that synthesizes D-glyceraldehyde 3-phosphate from glycerone phosphate.PROSITE-ProRule annotation This subpathway is part of the pathway glycolysis, which is itself part of Carbohydrate degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes D-glyceraldehyde 3-phosphate from glycerone phosphate, the pathway glycolysis and in Carbohydrate degradation.

Pathwayi: gluconeogenesis

This protein is involved in the pathway gluconeogenesis, which is part of Carbohydrate biosynthesis.PROSITE-ProRule annotation
View all proteins of this organism that are known to be involved in the pathway gluconeogenesis and in Carbohydrate biosynthesis.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei12SubstratePROSITE-ProRule annotation1
Binding sitei14SubstratePROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei96ElectrophilePROSITE-ProRule annotation1
Active sitei166Proton acceptorPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIsomerase, Lyase
Biological processGluconeogenesis, Glycolysis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-70171, Glycolysis
R-MMU-70263, Gluconeogenesis

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
P17751

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00109;UER00189
UPA00138

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Triosephosphate isomerase (EC:5.3.1.1PROSITE-ProRule annotation)
Short name:
TIM
Alternative name(s):
Methylglyoxal synthaseBy similarity (EC:4.2.3.3By similarity)
Triose-phosphate isomerase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Tpi1
Synonyms:Tpi
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:98797, Tpi1

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000023456

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi163L → Q: 50% reduced activity. 1 Publication1
Mutagenesisi193L → Q: 50% reduced activity. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000901162 – 249Triosephosphate isomeraseAdd BLAST248

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei14N6-acetyllysineBy similarity1
Modified residuei683'-nitrotyrosineCombined sources1
Modified residuei80PhosphoserineBy similarity1
Modified residuei106PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki142Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)By similarity
Modified residuei149N6-succinyllysineCombined sources1
Modified residuei156N6-acetyllysine; alternateCombined sources1
Modified residuei156N6-succinyllysine; alternateCombined sources1
Modified residuei159PhosphoserineCombined sources1
Modified residuei173PhosphothreonineCombined sources1
Modified residuei194N6-acetyllysine; alternateCombined sources1
Modified residuei194N6-methyllysine; alternateBy similarity1
Modified residuei194N6-succinyllysine; alternateCombined sources1
Modified residuei2093'-nitrotyrosineCombined sources1
Modified residuei212PhosphoserineCombined sources1
Modified residuei214PhosphothreonineBy similarity1
Modified residuei223PhosphoserineBy similarity1
Modified residuei238N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation, Isopeptide bond, Methylation, Nitration, Phosphoprotein, Ubl conjugation

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
non-CPTAC-3752

Encyclopedia of Proteome Dynamics

More...
EPDi
P17751

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P17751

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P17751

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P17751

PeptideAtlas

More...
PeptideAtlasi
P17751

PRoteomics IDEntifications database

More...
PRIDEi
P17751

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
259059 [P17751-1]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P17751-2

2D gel databases

2-DE database at Universidad Complutense de Madrid

More...
COMPLUYEAST-2DPAGEi
P17751

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
IPI00467833
P17751

Two-dimensional polyacrylamide gel electrophoresis database from the Geneva University Hospital

More...
SWISS-2DPAGEi
P17751

University College Dublin 2-DE Proteome Database

More...
UCD-2DPAGEi
P17751

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P17751

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P17751

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P17751

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000023456, Expressed in muscle of leg and 348 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P17751, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P17751, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

PROSITE-ProRule annotation

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
204290, 49 interactors

Protein interaction database and analysis system

More...
IntActi
P17751, 13 interactors

Molecular INTeraction database

More...
MINTi
P17751

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000130858

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P17751, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P17751

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the triosephosphate isomerase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1643, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000013354

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_024251_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P17751

Identification of Orthologs from Complete Genome Data

More...
OMAi
QEVCGAI

Database of Orthologous Groups

More...
OrthoDBi
1272577at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P17751

TreeFam database of animal gene trees

More...
TreeFami
TF300829

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00311, TIM, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.20.20.70, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_00147_B, TIM_B, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013785, Aldolase_TIM
IPR035990, TIM_sf
IPR022896, TrioseP_Isoase_bac/euk
IPR000652, Triosephosphate_isomerase
IPR020861, Triosephosphate_isomerase_AS

The PANTHER Classification System

More...
PANTHERi
PTHR21139, PTHR21139, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00121, TIM, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51351, SSF51351, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00419, tim, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00171, TIM_1, 1 hit
PS51440, TIM_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative initiation. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P17751-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPTRKFFVG GNWKMNGRKK CLGELICTLN AANVPAGTEV VCAPPTAYID
60 70 80 90 100
FARQKLDPKI AVAAQNCYKV TNGAFTGEIS PGMIKDLGAT WVVLGHSERR
110 120 130 140 150
HVFGESDELI GQKVSHALAE GLGVIACIGE KLDEREAGIT EKVVFEQTKV
160 170 180 190 200
IADNVKDWSK VVLAYEPVWA IGTGKTATPQ QAQEVHEKLR GWLKSNVNDG
210 220 230 240
VAQSTRIIYG GSVTGATCKE LASQPDVDGF LVGGASLKPE FVDIINAKQ
Length:249
Mass (Da):26,713
Last modified:October 7, 2020 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4C69846D0C8AF33A
GO
Isoform 2 (identifier: P17751-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEGKAEQQGAGLTMAEGGEKEEFCFTAIYISGQWREPCVCTDLQRLEPGTM

Show »
Length:299
Mass (Da):32,192
Checksum:iD465FD57108A3BD4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BXC3H7BXC3_MOUSE
Triosephosphate isomerase
Tpi1
167Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti74A → P in CAA37420 (PubMed:2377473).Curated1
Sequence conflicti107D → G in BAE39523 (PubMed:16141072).Curated1
Sequence conflicti194K → R in BAB27194 (PubMed:16141072).Curated1
Sequence conflicti195S → P in BAE26832 (PubMed:16141072).Curated1
Sequence conflicti216A → G in BAB27194 (PubMed:16141072).Curated1
Sequence conflicti222A → Q in BAB27194 (PubMed:16141072).Curated1
Sequence conflicti223 – 225SQP → TPA in CAA37420 (PubMed:2377473).Curated3
Sequence conflicti227V → M in BAB25634 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0607241M → MEGKAEQQGAGLTMAEGGEK EEFCFTAIYISGQWREPCVC TDLQRLEPGTM in isoform 2. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC002397 Genomic DNA Translation: AAC36016.1
AC142254 Genomic DNA No translation available.
AK008373 mRNA Translation: BAB25634.1
AK010808 mRNA Translation: BAB27194.1
AK146013 mRNA Translation: BAE26832.1
AK149768 mRNA Translation: BAE29073.1
AK150735 mRNA Translation: BAE29810.1
AK159741 mRNA Translation: BAE35334.1
AK167437 mRNA Translation: BAE39523.1
AK168446 mRNA Translation: BAE40350.1
AK168756 mRNA Translation: BAE40594.1
X53333 mRNA Translation: CAA37420.1
BC046761 mRNA Translation: AAH46761.1
L31777 Genomic DNA Translation: AAB48543.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS20530.2 [P17751-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S10490, ISMST

NCBI Reference Sequences

More...
RefSeqi
NP_033441.2, NM_009415.2 [P17751-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000172132; ENSMUSP00000130858; ENSMUSG00000023456 [P17751-1]
ENSMUST00000239432; ENSMUSP00000159368; ENSMUSG00000023456 [P17751-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
21991

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:21991

UCSC genome browser

More...
UCSCi
uc012esp.1, mouse [P17751-1]

Keywords - Coding sequence diversityi

Alternative initiation

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC002397 Genomic DNA Translation: AAC36016.1
AC142254 Genomic DNA No translation available.
AK008373 mRNA Translation: BAB25634.1
AK010808 mRNA Translation: BAB27194.1
AK146013 mRNA Translation: BAE26832.1
AK149768 mRNA Translation: BAE29073.1
AK150735 mRNA Translation: BAE29810.1
AK159741 mRNA Translation: BAE35334.1
AK167437 mRNA Translation: BAE39523.1
AK168446 mRNA Translation: BAE40350.1
AK168756 mRNA Translation: BAE40594.1
X53333 mRNA Translation: CAA37420.1
BC046761 mRNA Translation: AAH46761.1
L31777 Genomic DNA Translation: AAB48543.1
CCDSiCCDS20530.2 [P17751-1]
PIRiS10490, ISMST
RefSeqiNP_033441.2, NM_009415.2 [P17751-1]

3D structure databases

SMRiP17751
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi204290, 49 interactors
IntActiP17751, 13 interactors
MINTiP17751
STRINGi10090.ENSMUSP00000130858

PTM databases

iPTMnetiP17751
PhosphoSitePlusiP17751
SwissPalmiP17751

2D gel databases

COMPLUYEAST-2DPAGEiP17751
REPRODUCTION-2DPAGEiIPI00467833
P17751
SWISS-2DPAGEiP17751
UCD-2DPAGEiP17751

Proteomic databases

CPTACinon-CPTAC-3752
EPDiP17751
jPOSTiP17751
MaxQBiP17751
PaxDbiP17751
PeptideAtlasiP17751
PRIDEiP17751
ProteomicsDBi259059 [P17751-1]
TopDownProteomicsiP17751-2

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
22744, 469 antibodies

The DNASU plasmid repository

More...
DNASUi
21991

Genome annotation databases

EnsembliENSMUST00000172132; ENSMUSP00000130858; ENSMUSG00000023456 [P17751-1]
ENSMUST00000239432; ENSMUSP00000159368; ENSMUSG00000023456 [P17751-2]
GeneIDi21991
KEGGimmu:21991
UCSCiuc012esp.1, mouse [P17751-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7167
MGIiMGI:98797, Tpi1
VEuPathDBiHostDB:ENSMUSG00000023456

Phylogenomic databases

eggNOGiKOG1643, Eukaryota
GeneTreeiENSGT00390000013354
HOGENOMiCLU_024251_2_0_1
InParanoidiP17751
OMAiQEVCGAI
OrthoDBi1272577at2759
PhylomeDBiP17751
TreeFamiTF300829

Enzyme and pathway databases

UniPathwayiUPA00109;UER00189
UPA00138
ReactomeiR-MMU-70171, Glycolysis
R-MMU-70263, Gluconeogenesis
SABIO-RKiP17751

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
21991, 26 hits in 63 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Tpi1, mouse

Protein Ontology

More...
PROi
PR:P17751
RNActiP17751, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000023456, Expressed in muscle of leg and 348 other tissues
ExpressionAtlasiP17751, baseline and differential
GenevisibleiP17751, MM

Family and domain databases

CDDicd00311, TIM, 1 hit
Gene3Di3.20.20.70, 1 hit
HAMAPiMF_00147_B, TIM_B, 1 hit
InterProiView protein in InterPro
IPR013785, Aldolase_TIM
IPR035990, TIM_sf
IPR022896, TrioseP_Isoase_bac/euk
IPR000652, Triosephosphate_isomerase
IPR020861, Triosephosphate_isomerase_AS
PANTHERiPTHR21139, PTHR21139, 1 hit
PfamiView protein in Pfam
PF00121, TIM, 1 hit
SUPFAMiSSF51351, SSF51351, 1 hit
TIGRFAMsiTIGR00419, tim, 1 hit
PROSITEiView protein in PROSITE
PS00171, TIM_1, 1 hit
PS51440, TIM_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTPIS_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P17751
Secondary accession number(s): Q3TJH2
, Q3UC04, Q3UKG9, Q64513, Q9CVF9, Q9CWE7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: October 7, 2020
Last modified: September 29, 2021
This is version 188 of the entry and version 5 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again