Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P17706 (PTN2_HUMAN)

Entry version 203 (31 Jul 2019)
Sequence version 2 (05 May 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Tyrosine-protein phosphatase non-receptor type 2

Gene

PTPN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Non-receptor type tyrosine-specific phosphatase that dephosphorylates receptor protein tyrosine kinases including INSR, EGFR, CSF1R, PDGFR. Also dephosphorylates non-receptor protein tyrosine kinases like JAK1, JAK2, JAK3, Src family kinases, STAT1, STAT3 and STAT6 either in the nucleus or the cytoplasm. Negatively regulates numerous signaling pathways and biological processes like hematopoiesis, inflammatory response, cell proliferation and differentiation, and glucose homeostasis. Plays a multifaceted and important role in the development of the immune system. Functions in T-cell receptor signaling through dephosphorylation of FYN and LCK to control T-cells differentiation and activation. Dephosphorylates CSF1R, negatively regulating its downstream signaling and macrophage differentiation. Negatively regulates cytokine (IL2/interleukin-2 and interferon)-mediated signaling through dephosphorylation of the cytoplasmic kinases JAK1, JAK3 and their substrate STAT1, that propagate signaling downstream of the cytokine receptors. Also regulates the IL6/interleukin-6 and IL4/interleukin-4 cytokine signaling through dephosphorylation of STAT3 and STAT6 respectively. In addition to the immune system, it is involved in anchorage-dependent, negative regulation of EGF-stimulated cell growth. Activated by the integrin ITGA1/ITGB1, it dephosphorylates EGFR and negatively regulates EGF signaling. Dephosphorylates PDGFRB and negatively regulates platelet-derived growth factor receptor-beta signaling pathway and therefore cell proliferation. Negatively regulates tumor necrosis factor-mediated signaling downstream via MAPK through SRC dephosphorylation. May also regulate the hepatocyte growth factor receptor signaling pathway through dephosphorylation of the hepatocyte growth factor receptor MET. Plays also an important role in glucose homeostasis. For instance, negatively regulates the insulin receptor signaling pathway through the dephosphorylation of INSR and control gluconeogenesis and liver glucose production through negative regulation of the IL6 signaling pathways. May also bind DNA.9 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.48 mM for p-nitrophenyl phosphate (at pH 6.5 and 25 degrees Celsius)1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei182SubstrateBy similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei216Phosphocysteine intermediatePROSITE-ProRule annotation1
    Binding sitei260SubstrateBy similarity1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    Complete GO annotation on QuickGO ...

    GO - Biological processi

    Complete GO annotation on QuickGO ...

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionHydrolase, Protein phosphatase

    Enzyme and pathway databases

    BRENDA Comprehensive Enzyme Information System

    More...    BRENDAi    		3.1.3.48 2681

    Reactome - a knowledgebase of biological pathways and processes

    More...    Reactomei    		R-HSA-6807004 Negative regulation of MET activity
    R-HSA-877312 Regulation of IFNG signaling
    R-HSA-9008059 Interleukin-37 signaling

    SignaLink: a signaling pathway resource with multi-layered regulatory networks

    More...    SignaLinki    		P17706

    SIGNOR Signaling Network Open Resource

    More...    SIGNORi    		P17706

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Tyrosine-protein phosphatase non-receptor type 2 (EC:3.1.3.48)
    Alternative name(s):
    T-cell protein-tyrosine phosphatase
    Short name:
    TCPTP
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:PTPN2
    Synonyms:PTPT
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

    Organism-specific databases

    Human Gene Nomenclature Database

    More...    HGNCi    		HGNC:9650 PTPN2

    Online Mendelian Inheritance in Man (OMIM)

    More...    MIMi    		176887 gene

    neXtProt; the human protein knowledge platform

    More...    neXtProti    		NX_P17706

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Endoplasmic reticulum, Membrane, Nucleus

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi182D → A: Substrate-trapping mutant; catalytically inactive it forms a stable complex with physiological substrates including INSR and EGFR. Accumulates in the cytoplasm upon stimulation by insulin or EGF; isoform 2. 2 Publications1
    Mutagenesisi222R → M: Impairs phosphatase activity. 1
    Mutagenesisi304S → A: Alters phosphorylation by cyclin-dependent kinases of isoform 2 but has no effect on its phosphatase activity. 1 Publication1
    Mutagenesisi350 – 352RKR → QQQ: Alters location to the endoplasmic reticulum; isoform 1. 1 Publication3
    Mutagenesisi380K → Q: Prevents location to the nucleus; isoform 2. 1 Publication1

    Organism-specific databases

    DisGeNET

    More...    DisGeNETi    		5771

    MalaCards human disease database

    More...    MalaCardsi    		PTPN2

    Open Targets

    More...    OpenTargetsi    		ENSG00000175354

    Orphanet; a database dedicated to information on rare diseases and orphan drugs

    More...    Orphaneti    		206 NON RARE IN EUROPE: Crohn disease
    771 NON RARE IN EUROPE: Ulcerative colitis
    85410 Oligoarticular juvenile idiopathic arthritis
    85408 Rheumatoid factor-negative juvenile idiopathic arthritis

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...    PharmGKBi    		PA33993

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...    ChEMBLi    		CHEMBL3807

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...    BioMutai    		PTPN2

    Domain mapping of disease mutations (DMDM)

    More...    DMDMi    		229462762

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000947521 – 415Tyrosine-protein phosphatase non-receptor type 2Add BLAST415

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei22PhosphotyrosineBy similarity1
    Modified residuei52PhosphoserineBy similarity1
    Modified residuei68PhosphotyrosineBy similarity1
    Modified residuei216S-nitrosocysteineBy similarity1
    Modified residuei293PhosphoserineCombined sources1
    Modified residuei298PhosphoserineCombined sources1
    Modified residuei304PhosphoserineCombined sources1
    Isoform 2 (identifier: P17706-2)
    Modified residuei304Phosphoserine1 Publication1 Publication1

    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

    Isoform 2: Specifically phosphorylated in a cell cycle-dependent manner by cyclin-dependent kinases CDK1 and CDK2. Probably activated through phosphorylation by PKR.2 Publications

    Keywords - PTMi

    Phosphoprotein, S-nitrosylation

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...    EPDi    		P17706

    jPOST - Japan Proteome Standard Repository/Database

    More...    jPOSTi    		P17706

    MaxQB - The MaxQuant DataBase

    More...    MaxQBi    		P17706

    PaxDb, a database of protein abundance averages across all three domains of life

    More...    PaxDbi    		P17706

    PeptideAtlas

    More...    PeptideAtlasi    		P17706

    PRoteomics IDEntifications database

    More...    PRIDEi    		P17706

    ProteomicsDB human proteome resource

    More...    ProteomicsDBi    		53507 [P17706-1]
    53508 [P17706-2]
    53509 [P17706-3]

    PTM databases

    DEPOD human dephosphorylation database

    More...    DEPODi    		P17706

    iPTMnet integrated resource for PTMs in systems biology context

    More...    iPTMneti    		P17706

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...    PhosphoSitePlusi    		P17706

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Ubiquitously expressed. Isoform 2 is probably the major isoform. Isoform 1 is expressed in T-cells and in placenta.2 Publications

    <p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

    Up-regulated by IL4/interleukin-4 (at protein level).1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...    Bgeei    		ENSG00000175354 Expressed in 231 organ(s), highest expression level in tendon of biceps brachii

    ExpressionAtlas, Differential and Baseline Expression

    More...    ExpressionAtlasi    		P17706 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...    Genevisiblei    		P17706 HS

    Organism-specific databases

    Human Protein Atlas

    More...    HPAi    		HPA015004
    HPA046176

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Interacts with RMDN3. Isoform 1 interacts with TMED9. Isoform 1 interacts with STX17; dephosphorylates STX17.

    Interacts with ITGA1 (via cytoplasmic domain); activates the phosphatase activity towards EGFR.

    Interacts with TRAF2; probably involved in tumor necrosis factor-mediated signaling.

    Interacts with MET.

    7 Publications

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    GO - Molecular functioni

    Complete GO annotation on QuickGO ...

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...    BioGridi    		111737, 104 interactors

    CORUM comprehensive resource of mammalian protein complexes

    More...    CORUMi    		P17706

    Protein interaction database and analysis system

    More...    IntActi    		P17706, 26 interactors

    Molecular INTeraction database

    More...    MINTi    		P17706

    STRING: functional protein association networks

    More...    STRINGi    		9606.ENSP00000311857

    Chemistry databases

    BindingDB database of measured binding affinities

    More...    BindingDBi    		P17706

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    1415
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...    SMRi    		P17706

    Database of comparative protein structure models

    More...    ModBasei    		Search...

    Miscellaneous databases

    Relative evolutionary importance of amino acids within a protein sequence

    More...    EvolutionaryTracei    		P17706

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini5 – 275Tyrosine-protein phosphatasePROSITE-ProRule annotationAdd BLAST271

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni216 – 222Substrate bindingBy similarity7
    Regioni346 – 415Endoplasmic reticulum locationAdd BLAST70
    Regioni376 – 415Mediates interaction with STX171 PublicationAdd BLAST40

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily.Curated

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...    eggNOGi    		KOG0789 Eukaryota
    COG5599 LUCA

    Ensembl GeneTree

    More...    GeneTreei    		ENSGT00940000154686

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...    HOGENOMi    		HOG000273908

    InParanoid: Eukaryotic Ortholog Groups

    More...    InParanoidi    		P17706

    KEGG Orthology (KO)

    More...    KOi    		K18026

    Identification of Orthologs from Complete Genome Data

    More...    OMAi    		QSHECSY

    Database of Orthologous Groups

    More...    OrthoDBi    		411281at2759

    Database for complete collections of gene phylogenies

    More...    PhylomeDBi    		P17706

    TreeFam database of animal gene trees

    More...    TreeFami    		TF315897

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...    Gene3Di    		3.90.190.10, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...    InterProi    		View protein in InterPro
    IPR029021 Prot-tyrosine_phosphatase-like
    IPR000242 PTPase_domain
    IPR012265 Ptpn1/Ptpn2
    IPR016130 Tyr_Pase_AS
    IPR003595 Tyr_Pase_cat
    IPR000387 TYR_PHOSPHATASE_dom

    Pfam protein domain database

    More...    Pfami    		View protein in Pfam
    PF00102 Y_phosphatase, 1 hit

    PIRSF; a whole-protein classification database

    More...    PIRSFi    		PIRSF000926 Tyr-Ptase_nr1, 1 hit

    Protein Motif fingerprint database; a protein domain database

    More...    PRINTSi    		PR00700 PRTYPHPHTASE

    Simple Modular Architecture Research Tool; a protein domain database

    More...    SMARTi    		View protein in SMART
    SM00194 PTPc, 1 hit
    SM00404 PTPc_motif, 1 hit

    Superfamily database of structural and functional annotation

    More...    SUPFAMi    		SSF52799 SSF52799, 1 hit

    PROSITE; a protein domain and family database

    More...    PROSITEi    		View protein in PROSITE
    PS00383 TYR_PHOSPHATASE_1, 1 hit
    PS50056 TYR_PHOSPHATASE_2, 1 hit
    PS50055 TYR_PHOSPHATASE_PTP, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 4 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: P17706-1) [UniParc]FASTAAdd to basket
    Also known as: PTPB, p48TC, TC48, TC-PTPb

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MPTTIEREFE ELDTQRRWQP LYLEIRNESH DYPHRVAKFP ENRNRNRYRD 
            60         70         80         90        100
    VSPYDHSRVK LQNAENDYIN ASLVDIEEAQ RSYILTQGPL PNTCCHFWLM 
           110        120        130        140        150
    VWQQKTKAVV MLNRIVEKES VKCAQYWPTD DQEMLFKETG FSVKLLSEDV 
           160        170        180        190        200
    KSYYTVHLLQ LENINSGETR TISHFHYTTW PDFGVPESPA SFLNFLFKVR 
           210        220        230        240        250
    ESGSLNPDHG PAVIHCSAGI GRSGTFSLVD TCLVLMEKGD DINIKQVLLN 
           260        270        280        290        300
    MRKYRMGLIQ TPDQLRFSYM AIIEGAKCIK GDSSIQKRWK ELSKEDLSPA 
           310        320        330        340        350
    FDHSPNKIMT EKYNGNRIGL EEEKLTGDRC TGLSSKMQDT MEENSESALR 
           360        370        380        390        400
    KRIREDRKAT TAQKVQQMKQ RLNENERKRK RWLYWQPILT KMGFMSVILV 
           410 
    GAFVGWTLFF QQNAL
    Note: Minor isoform.
    Length:415
    Mass (Da):48,473
    Last modified:May 5, 2009 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0207694A4F058E68
    GO
    Isoform 2 (identifier: P17706-2) [UniParc]FASTAAdd to basket
    Also known as: PTPA, p45TC, TC45, TC-PTPa

    The sequence of this isoform differs from the canonical sequence as follows:
         382-415: WLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL → PRLTDT

    Note: Major isoform.1 Publication1 Publication Contains a nuclear location signal at positions 377-381 (PubMed:7593185) and an autoinhibitory region acting through intramolecular interactions is found at positions 353-387.1 Publication1 Publication
    Show »
    Length:387
    Mass (Da):45,168
    Checksum:i0F3E622EBA5A92CB
    GO
    Isoform 3 (identifier: P17706-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         347-380: Missing.
         382-415: WLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL → PRLTDT

    Note: No experimental confirmation available.
    Show »
    Length:353
    Mass (Da):40,990
    Checksum:i5AE668EB7D76CB93
    GO
    Isoform 4 (identifier: P17706-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         165-165: N → NYIENLWITLYLKLLMLDVKRSLK
         382-415: WLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL → PRLTDT

    Note: No experimental confirmation available. Gene prediction based on cDNA data.
    Show »
    Length:410
    Mass (Da):48,017
    Checksum:iD6463B9A0F952068
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    		Gene namesLengthAnnotation
    K7EQG9K7EQG9_HUMAN
    Tyrosine-protein phosphatase non-re...
    PTPN2
    		386Annotation score:

    Annotation score:3 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    K7ENP9K7ENP9_HUMAN
    Tyrosine-protein phosphatase non-re...
    PTPN2
    		146Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    D3DUJ3D3DUJ3_HUMAN
    Protein tyrosine phosphatase, non-r...
    PTPN2 hCG_1999834
    		316Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    K7EIY0K7EIY0_HUMAN
    Tyrosine-protein phosphatase non-re...
    PTPN2
    		112Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    K7EIE9K7EIE9_HUMAN
    Tyrosine-protein phosphatase non-re...
    PTPN2
    		151Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    K7ER87K7ER87_HUMAN
    Tyrosine-protein phosphatase non-re...
    PTPN2
    		165Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    K7ELS9K7ELS9_HUMAN
    Tyrosine-protein phosphatase non-re...
    PTPN2
    		68Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    K7ERU1K7ERU1_HUMAN
    Tyrosine-protein phosphatase non-re...
    PTPN2
    		42Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A2R8YD79A0A2R8YD79_HUMAN
    Tyrosine-protein phosphatase non-re...
    PTPN2
    		166Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti407T → R in AAA65997 (PubMed:2546150).Curated1
    Sequence conflicti407T → R in M81478 (PubMed:1731319).Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_054821165N → NYIENLWITLYLKLLMLDVK RSLK in isoform 4. Curated1
    Alternative sequenceiVSP_043383347 – 380Missing in isoform 3. 1 PublicationAdd BLAST34
    Alternative sequenceiVSP_005125382 – 415WLYWQ…QQNAL → PRLTDT in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST34

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...    EMBLi

    GenBank nucleotide sequence database

    More...    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...    DDBJi
    Links Updated
    		M25393 mRNA Translation: AAA65997.1
    AK292570 mRNA Translation: BAF85259.1
    EF445017 Genomic DNA Translation: ACA06062.1
    EF445017 Genomic DNA Translation: ACA06064.1
    AP001077 Genomic DNA No translation available.
    AP002449 Genomic DNA No translation available.
    AP005482 Genomic DNA No translation available.
    CH471113 Genomic DNA Translation: EAX01532.1
    CH471113 Genomic DNA Translation: EAX01539.1
    BC008244 mRNA Translation: AAH08244.1
    BC016727 mRNA Translation: AAH16727.1
    M81478 mRNA No translation available.

    The Consensus CDS (CCDS) project

    More...    CCDSi    		CCDS11863.1 [P17706-2]
    CCDS11864.1 [P17706-3]
    CCDS11865.1 [P17706-1]
    CCDS59306.1 [P17706-4]

    Protein sequence database of the Protein Information Resource

    More...    PIRi    		A33899

    NCBI Reference Sequences

    More...    RefSeqi    		NP_001193942.1, NM_001207013.1 [P17706-4]
    NP_002819.2, NM_002828.3 [P17706-1]
    NP_536347.1, NM_080422.2 [P17706-2]
    NP_536348.1, NM_080423.2 [P17706-3]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...    Ensembli    		ENST00000309660; ENSP00000311857; ENSG00000175354 [P17706-1]
    ENST00000327283; ENSP00000320298; ENSG00000175354 [P17706-2]
    ENST00000353319; ENSP00000320546; ENSG00000175354 [P17706-3]
    ENST00000591115; ENSP00000466936; ENSG00000175354 [P17706-4]

    Database of genes from NCBI RefSeq genomes

    More...    GeneIDi    		5771

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...    KEGGi    		hsa:5771

    UCSC genome browser

    More...    UCSCi    		uc002krl.4 human [P17706-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    		M25393 mRNA Translation: AAA65997.1
    AK292570 mRNA Translation: BAF85259.1
    EF445017 Genomic DNA Translation: ACA06062.1
    EF445017 Genomic DNA Translation: ACA06064.1
    AP001077 Genomic DNA No translation available.
    AP002449 Genomic DNA No translation available.
    AP005482 Genomic DNA No translation available.
    CH471113 Genomic DNA Translation: EAX01532.1
    CH471113 Genomic DNA Translation: EAX01539.1
    BC008244 mRNA Translation: AAH08244.1
    BC016727 mRNA Translation: AAH16727.1
    M81478 mRNA No translation available.
    CCDSiCCDS11863.1 [P17706-2]
    CCDS11864.1 [P17706-3]
    CCDS11865.1 [P17706-1]
    CCDS59306.1 [P17706-4]
    PIRiA33899
    RefSeqiNP_001193942.1, NM_001207013.1 [P17706-4]
    NP_002819.2, NM_002828.3 [P17706-1]
    NP_536347.1, NM_080422.2 [P17706-2]
    NP_536348.1, NM_080423.2 [P17706-3]

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...    PDBei

    Protein Data Bank RCSB

    More...    RCSB PDBi

    Protein Data Bank Japan

    More...    PDBji
    Links Updated
    		PDB entryMethodResolution (Å)ChainPositionsPDBsum
    1L8KX-ray2.56A1-314[»]
    SMRiP17706
    ModBaseiSearch...

    Protein-protein interaction databases

    BioGridi111737, 104 interactors
    CORUMiP17706
    IntActiP17706, 26 interactors
    MINTiP17706
    STRINGi9606.ENSP00000311857

    Chemistry databases

    BindingDBiP17706
    ChEMBLiCHEMBL3807

    PTM databases

    DEPODiP17706
    iPTMnetiP17706
    PhosphoSitePlusiP17706

    Polymorphism and mutation databases

    BioMutaiPTPN2
    DMDMi229462762

    Proteomic databases

    EPDiP17706
    jPOSTiP17706
    MaxQBiP17706
    PaxDbiP17706
    PeptideAtlasiP17706
    PRIDEiP17706
    ProteomicsDBi53507 [P17706-1]
    53508 [P17706-2]
    53509 [P17706-3]

    Protocols and materials databases

    The DNASU plasmid repository

    More...    DNASUi    		5771
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000309660; ENSP00000311857; ENSG00000175354 [P17706-1]
    ENST00000327283; ENSP00000320298; ENSG00000175354 [P17706-2]
    ENST00000353319; ENSP00000320546; ENSG00000175354 [P17706-3]
    ENST00000591115; ENSP00000466936; ENSG00000175354 [P17706-4]
    GeneIDi5771
    KEGGihsa:5771
    UCSCiuc002krl.4 human [P17706-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...    CTDi    		5771
    DisGeNETi5771

    GeneCards: human genes, protein and diseases

    More...    GeneCardsi    		PTPN2
    HGNCiHGNC:9650 PTPN2
    HPAiHPA015004
    HPA046176
    MalaCardsiPTPN2
    MIMi176887 gene
    neXtProtiNX_P17706
    OpenTargetsiENSG00000175354
    Orphaneti206 NON RARE IN EUROPE: Crohn disease
    771 NON RARE IN EUROPE: Ulcerative colitis
    85410 Oligoarticular juvenile idiopathic arthritis
    85408 Rheumatoid factor-negative juvenile idiopathic arthritis
    PharmGKBiPA33993

    GenAtlas: human gene database

    More...    GenAtlasi    		Search...

    Phylogenomic databases

    eggNOGiKOG0789 Eukaryota
    COG5599 LUCA
    GeneTreeiENSGT00940000154686
    HOGENOMiHOG000273908
    InParanoidiP17706
    KOiK18026
    OMAiQSHECSY
    OrthoDBi411281at2759
    PhylomeDBiP17706
    TreeFamiTF315897

    Enzyme and pathway databases

    BRENDAi3.1.3.48 2681
    ReactomeiR-HSA-6807004 Negative regulation of MET activity
    R-HSA-877312 Regulation of IFNG signaling
    R-HSA-9008059 Interleukin-37 signaling
    SignaLinkiP17706
    SIGNORiP17706

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...    ChiTaRSi    		PTPN2 human
    EvolutionaryTraceiP17706

    The Gene Wiki collection of pages on human genes and proteins

    More...    GeneWikii    		PTPN2

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...    GenomeRNAii    		5771

    Protein Ontology

    More...    PROi    		PR:P17706

    The Stanford Online Universal Resource for Clones and ESTs

    More...    SOURCEi    		Search...

    Gene expression databases

    BgeeiENSG00000175354 Expressed in 231 organ(s), highest expression level in tendon of biceps brachii
    ExpressionAtlasiP17706 baseline and differential
    GenevisibleiP17706 HS

    Family and domain databases

    Gene3Di3.90.190.10, 1 hit
    InterProiView protein in InterPro
    IPR029021 Prot-tyrosine_phosphatase-like
    IPR000242 PTPase_domain
    IPR012265 Ptpn1/Ptpn2
    IPR016130 Tyr_Pase_AS
    IPR003595 Tyr_Pase_cat
    IPR000387 TYR_PHOSPHATASE_dom
    PfamiView protein in Pfam
    PF00102 Y_phosphatase, 1 hit
    PIRSFiPIRSF000926 Tyr-Ptase_nr1, 1 hit
    PRINTSiPR00700 PRTYPHPHTASE
    SMARTiView protein in SMART
    SM00194 PTPc, 1 hit
    SM00404 PTPc_motif, 1 hit
    SUPFAMiSSF52799 SSF52799, 1 hit
    PROSITEiView protein in PROSITE
    PS00383 TYR_PHOSPHATASE_1, 1 hit
    PS50056 TYR_PHOSPHATASE_2, 1 hit
    PS50055 TYR_PHOSPHATASE_PTP, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...    ProtoNeti    		Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...    MobiDBi    		Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPTN2_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P17706
    Secondary accession number(s): A8K955
    , A8MXU3, K7ENG3, Q96AU5, Q96HR2
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1990
    Last sequence update: May 5, 2009
    Last modified: July 31, 2019
    This is version 203 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    2. SIMILARITY comments
      Index of protein domains and families
    3. Human chromosome 18
      Human chromosome 18: entries, gene names and cross-references to MIM
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again