Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - P17706 (PTN2_HUMAN)

Entry version 216 (29 Sep 2021)
Sequence version 2 (05 May 2009)
Previous versions | rss
Add a publicationFeedback
Protein

Tyrosine-protein phosphatase non-receptor type 2

Gene

PTPN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Non-receptor type tyrosine-specific phosphatase that dephosphorylates receptor protein tyrosine kinases including INSR, EGFR, CSF1R, PDGFR. Also dephosphorylates non-receptor protein tyrosine kinases like JAK1, JAK2, JAK3, Src family kinases, STAT1, STAT3 and STAT6 either in the nucleus or the cytoplasm. Negatively regulates numerous signaling pathways and biological processes like hematopoiesis, inflammatory response, cell proliferation and differentiation, and glucose homeostasis. Plays a multifaceted and important role in the development of the immune system. Functions in T-cell receptor signaling through dephosphorylation of FYN and LCK to control T-cells differentiation and activation. Dephosphorylates CSF1R, negatively regulating its downstream signaling and macrophage differentiation. Negatively regulates cytokine (IL2/interleukin-2 and interferon)-mediated signaling through dephosphorylation of the cytoplasmic kinases JAK1, JAK3 and their substrate STAT1, that propagate signaling downstream of the cytokine receptors. Also regulates the IL6/interleukin-6 and IL4/interleukin-4 cytokine signaling through dephosphorylation of STAT3 and STAT6 respectively. In addition to the immune system, it is involved in anchorage-dependent, negative regulation of EGF-stimulated cell growth. Activated by the integrin ITGA1/ITGB1, it dephosphorylates EGFR and negatively regulates EGF signaling. Dephosphorylates PDGFRB and negatively regulates platelet-derived growth factor receptor-beta signaling pathway and therefore cell proliferation. Negatively regulates tumor necrosis factor-mediated signaling downstream via MAPK through SRC dephosphorylation. May also regulate the hepatocyte growth factor receptor signaling pathway through dephosphorylation of the hepatocyte growth factor receptor MET. Plays also an important role in glucose homeostasis. For instance, negatively regulates the insulin receptor signaling pathway through the dephosphorylation of INSR and control gluconeogenesis and liver glucose production through negative regulation of the IL6 signaling pathways. May also bind DNA.

9 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.48 mM for p-nitrophenyl phosphate (at pH 6.5 and 25 degrees Celsius)1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei182SubstrateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei216Phosphocysteine intermediatePROSITE-ProRule annotation1
Binding sitei260SubstrateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.1.3.48, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P17706

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6807004, Negative regulation of MET activity
R-HSA-877312, Regulation of IFNG signaling [P17706-2]
R-HSA-9008059, Interleukin-37 signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P17706

SIGNOR Signaling Network Open Resource

More...SIGNORi		P17706

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tyrosine-protein phosphatase non-receptor type 2 (EC:3.1.3.48)
Alternative name(s):
T-cell protein-tyrosine phosphatase
Short name:
TCPTP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PTPN2
Synonyms:PTPT
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:9650, PTPN2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		176887, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P17706

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000175354

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Endoplasmic reticulum, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi182D → A: Substrate-trapping mutant; catalytically inactive it forms a stable complex with physiological substrates including INSR and EGFR. Accumulates in the cytoplasm upon stimulation by insulin or EGF; isoform 2. 2 Publications1
Mutagenesisi222R → M: Impairs phosphatase activity. 1
Mutagenesisi304S → A: Alters phosphorylation by cyclin-dependent kinases of isoform 2 but has no effect on its phosphatase activity. 1 Publication1
Mutagenesisi350 – 352RKR → QQQ: Alters location to the endoplasmic reticulum; isoform 1. 1 Publication3
Mutagenesisi380K → Q: Prevents location to the nucleus; isoform 2. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		5771

MalaCards human disease database

More...MalaCardsi		PTPN2

Open Targets

More...OpenTargetsi		ENSG00000175354

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		206, NON RARE IN EUROPE: Crohn disease
771, NON RARE IN EUROPE: Ulcerative colitis
85410, Oligoarticular juvenile idiopathic arthritis
85408, Rheumatoid factor-negative polyarticular juvenile idiopathic arthritis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33993

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P17706, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3807

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PTPN2

Domain mapping of disease mutations (DMDM)

More...DMDMi		229462762

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000947521 – 415Tyrosine-protein phosphatase non-receptor type 2Add BLAST415

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei22PhosphotyrosineBy similarity1
Modified residuei52PhosphoserineBy similarity1
Modified residuei68PhosphotyrosineBy similarity1
Modified residuei216S-nitrosocysteineBy similarity1
Modified residuei293PhosphoserineCombined sources1
Modified residuei298PhosphoserineCombined sources1
Modified residuei304PhosphoserineCombined sources1
Isoform 2 (identifier: P17706-2)
Modified residuei304Phosphoserine1 Publication1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Specifically phosphorylated in a cell cycle-dependent manner by cyclin-dependent kinases CDK1 and CDK2. Probably activated through phosphorylation by PKR.2 Publications

Keywords - PTMi

Phosphoprotein, S-nitrosylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P17706

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P17706

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P17706

MaxQB - The MaxQuant DataBase

More...MaxQBi		P17706

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P17706

PeptideAtlas

More...PeptideAtlasi		P17706

PRoteomics IDEntifications database

More...PRIDEi		P17706

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		53507 [P17706-1]
53508 [P17706-2]
53509 [P17706-3]

PTM databases

DEPOD human dephosphorylation database

More...DEPODi		PTPN2

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P17706, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P17706

MetOSite database of methionine sulfoxide sites

More...MetOSitei		P17706

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P17706

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed. Isoform 2 is probably the major isoform. Isoform 1 is expressed in T-cells and in placenta.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by IL4/interleukin-4 (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000175354, Expressed in tendon of biceps brachii and 243 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P17706, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P17706, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000175354, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RMDN3.

Isoform 1 interacts with TMED9.

Isoform 1 interacts with STX17; dephosphorylates STX17.

Interacts with ITGA1 (via cytoplasmic domain); activates the phosphatase activity towards EGFR.

Interacts with TRAF2; probably involved in tumor necrosis factor-mediated signaling.

Interacts with MET.

7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		111737, 152 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P17706

Protein interaction database and analysis system

More...IntActi		P17706, 37 interactors

Molecular INTeraction database

More...MINTi		P17706

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000311857

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P17706

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P17706, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1415
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P17706

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P17706

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini5 – 275Tyrosine-protein phosphatasePROSITE-ProRule annotationAdd BLAST271

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni216 – 222Substrate bindingBy similarity7
Regioni346 – 415Endoplasmic reticulum locationAdd BLAST70
Regioni376 – 415Mediates interaction with STX171 PublicationAdd BLAST40

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0789, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154686

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_001645_9_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P17706

Identification of Orthologs from Complete Genome Data

More...OMAi		YPHKVAK

Database of Orthologous Groups

More...OrthoDBi		411281at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P17706

TreeFam database of animal gene trees

More...TreeFami		TF315897

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.90.190.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR029021, Prot-tyrosine_phosphatase-like
IPR000242, PTPase_domain
IPR012265, Ptpn1/Ptpn2
IPR016130, Tyr_Pase_AS
IPR003595, Tyr_Pase_cat
IPR000387, TYR_PHOSPHATASE_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00102, Y_phosphatase, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF000926, Tyr-Ptase_nr1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00700, PRTYPHPHTASE

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00194, PTPc, 1 hit
SM00404, PTPc_motif, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52799, SSF52799, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00383, TYR_PHOSPHATASE_1, 1 hit
PS50056, TYR_PHOSPHATASE_2, 1 hit
PS50055, TYR_PHOSPHATASE_PTP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P17706-1) [UniParc]FASTAAdd to basket
Also known as: PTPB, p48TC, TC48, TC-PTPb

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPTTIEREFE ELDTQRRWQP LYLEIRNESH DYPHRVAKFP ENRNRNRYRD 
        60         70         80         90        100
VSPYDHSRVK LQNAENDYIN ASLVDIEEAQ RSYILTQGPL PNTCCHFWLM 
       110        120        130        140        150
VWQQKTKAVV MLNRIVEKES VKCAQYWPTD DQEMLFKETG FSVKLLSEDV 
       160        170        180        190        200
KSYYTVHLLQ LENINSGETR TISHFHYTTW PDFGVPESPA SFLNFLFKVR 
       210        220        230        240        250
ESGSLNPDHG PAVIHCSAGI GRSGTFSLVD TCLVLMEKGD DINIKQVLLN 
       260        270        280        290        300
MRKYRMGLIQ TPDQLRFSYM AIIEGAKCIK GDSSIQKRWK ELSKEDLSPA 
       310        320        330        340        350
FDHSPNKIMT EKYNGNRIGL EEEKLTGDRC TGLSSKMQDT MEENSESALR 
       360        370        380        390        400
KRIREDRKAT TAQKVQQMKQ RLNENERKRK RWLYWQPILT KMGFMSVILV 
       410 
GAFVGWTLFF QQNAL
Note: Minor isoform.
Length:415
Mass (Da):48,473
Last modified:May 5, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0207694A4F058E68
GO
Isoform 2 (identifier: P17706-2) [UniParc]FASTAAdd to basket
Also known as: PTPA, p45TC, TC45, TC-PTPa

The sequence of this isoform differs from the canonical sequence as follows:
     382-415: WLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL → PRLTDT

Note: Major isoform. Contains a nuclear location signal at positions 377-381 (PubMed:7593185) and an autoinhibitory region acting through intramolecular interactions is found at positions 353-387.1 Publication1 Publication
Show »
Length:387
Mass (Da):45,168
Checksum:i0F3E622EBA5A92CB
GO
Isoform 3 (identifier: P17706-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     347-380: Missing.
     382-415: WLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL → PRLTDT

Show »
Length:353
Mass (Da):40,990
Checksum:i5AE668EB7D76CB93
GO
Isoform 4 (identifier: P17706-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     165-165: N → NYIENLWITLYLKLLMLDVKRSLK
     382-415: WLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL → PRLTDT

Show »
Length:410
Mass (Da):48,017
Checksum:iD6463B9A0F952068
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EQG9K7EQG9_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN2
386Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3DUJ3D3DUJ3_HUMAN
Protein tyrosine phosphatase, non-r...
PTPN2 hCG_1999834
316Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ENP9K7ENP9_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN2
146Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EIY0K7EIY0_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN2
112Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EIE9K7EIE9_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN2
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ERU1K7ERU1_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN2
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ER87K7ER87_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN2
165Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ELS9K7ELS9_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN2
68Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YD79A0A2R8YD79_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN2
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti407T → R in AAA65997 (PubMed:2546150).Curated1
Sequence conflicti407T → R in M81478 (PubMed:1731319).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_054821165N → NYIENLWITLYLKLLMLDVK RSLK in isoform 4. Curated1
Alternative sequenceiVSP_043383347 – 380Missing in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_005125382 – 415WLYWQ…QQNAL → PRLTDT in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M25393 mRNA Translation: AAA65997.1
AK292570 mRNA Translation: BAF85259.1
EF445017 Genomic DNA Translation: ACA06062.1
EF445017 Genomic DNA Translation: ACA06064.1
AP001077 Genomic DNA No translation available.
AP002449 Genomic DNA No translation available.
AP005482 Genomic DNA No translation available.
CH471113 Genomic DNA Translation: EAX01532.1
CH471113 Genomic DNA Translation: EAX01539.1
BC008244 mRNA Translation: AAH08244.1
BC016727 mRNA Translation: AAH16727.1
M81478 mRNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11863.1 [P17706-2]
CCDS11864.1 [P17706-3]
CCDS11865.1 [P17706-1]
CCDS59306.1 [P17706-4]

Protein sequence database of the Protein Information Resource

More...PIRi		A33899

NCBI Reference Sequences

More...RefSeqi		NP_001193942.1, NM_001207013.1 [P17706-4]
NP_002819.2, NM_002828.3 [P17706-1]
NP_536347.1, NM_080422.2 [P17706-2]
NP_536348.1, NM_080423.2 [P17706-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000309660; ENSP00000311857; ENSG00000175354 [P17706-1]
ENST00000327283; ENSP00000320298; ENSG00000175354 [P17706-2]
ENST00000353319; ENSP00000320546; ENSG00000175354 [P17706-3]
ENST00000591115; ENSP00000466936; ENSG00000175354 [P17706-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5771

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5771

UCSC genome browser

More...UCSCi		uc002krl.4, human [P17706-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M25393 mRNA Translation: AAA65997.1
AK292570 mRNA Translation: BAF85259.1
EF445017 Genomic DNA Translation: ACA06062.1
EF445017 Genomic DNA Translation: ACA06064.1
AP001077 Genomic DNA No translation available.
AP002449 Genomic DNA No translation available.
AP005482 Genomic DNA No translation available.
CH471113 Genomic DNA Translation: EAX01532.1
CH471113 Genomic DNA Translation: EAX01539.1
BC008244 mRNA Translation: AAH08244.1
BC016727 mRNA Translation: AAH16727.1
M81478 mRNA No translation available.
CCDSiCCDS11863.1 [P17706-2]
CCDS11864.1 [P17706-3]
CCDS11865.1 [P17706-1]
CCDS59306.1 [P17706-4]
PIRiA33899
RefSeqiNP_001193942.1, NM_001207013.1 [P17706-4]
NP_002819.2, NM_002828.3 [P17706-1]
NP_536347.1, NM_080422.2 [P17706-2]
NP_536348.1, NM_080423.2 [P17706-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1L8KX-ray2.56A1-314[»]
SMRiP17706
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi111737, 152 interactors
CORUMiP17706
IntActiP17706, 37 interactors
MINTiP17706
STRINGi9606.ENSP00000311857

Chemistry databases

BindingDBiP17706
ChEMBLiCHEMBL3807

PTM databases

DEPODiPTPN2
GlyGeniP17706, 1 site, 1 O-linked glycan (1 site)
iPTMnetiP17706
MetOSiteiP17706
PhosphoSitePlusiP17706

Genetic variation databases

BioMutaiPTPN2
DMDMi229462762

Proteomic databases

EPDiP17706
jPOSTiP17706
MassIVEiP17706
MaxQBiP17706
PaxDbiP17706
PeptideAtlasiP17706
PRIDEiP17706
ProteomicsDBi53507 [P17706-1]
53508 [P17706-2]
53509 [P17706-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		6936, 299 antibodies

The CPTC Antibody Portal

More...CPTCi		P17706, 1 antibody

The DNASU plasmid repository

More...DNASUi		5771

Genome annotation databases

EnsembliENST00000309660; ENSP00000311857; ENSG00000175354 [P17706-1]
ENST00000327283; ENSP00000320298; ENSG00000175354 [P17706-2]
ENST00000353319; ENSP00000320546; ENSG00000175354 [P17706-3]
ENST00000591115; ENSP00000466936; ENSG00000175354 [P17706-4]
GeneIDi5771
KEGGihsa:5771
UCSCiuc002krl.4, human [P17706-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5771
DisGeNETi5771

GeneCards: human genes, protein and diseases

More...GeneCardsi		PTPN2
HGNCiHGNC:9650, PTPN2
HPAiENSG00000175354, Low tissue specificity
MalaCardsiPTPN2
MIMi176887, gene
neXtProtiNX_P17706
OpenTargetsiENSG00000175354
Orphaneti206, NON RARE IN EUROPE: Crohn disease
771, NON RARE IN EUROPE: Ulcerative colitis
85410, Oligoarticular juvenile idiopathic arthritis
85408, Rheumatoid factor-negative polyarticular juvenile idiopathic arthritis
PharmGKBiPA33993
VEuPathDBiHostDB:ENSG00000175354

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0789, Eukaryota
GeneTreeiENSGT00940000154686
HOGENOMiCLU_001645_9_0_1
InParanoidiP17706
OMAiYPHKVAK
OrthoDBi411281at2759
PhylomeDBiP17706
TreeFamiTF315897

Enzyme and pathway databases

BRENDAi3.1.3.48, 2681
PathwayCommonsiP17706
ReactomeiR-HSA-6807004, Negative regulation of MET activity
R-HSA-877312, Regulation of IFNG signaling [P17706-2]
R-HSA-9008059, Interleukin-37 signaling
SignaLinkiP17706
SIGNORiP17706

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		5771, 24 hits in 1023 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PTPN2, human
EvolutionaryTraceiP17706

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PTPN2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5771
PharosiP17706, Tchem

Protein Ontology

More...PROi		PR:P17706
RNActiP17706, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000175354, Expressed in tendon of biceps brachii and 243 other tissues
ExpressionAtlasiP17706, baseline and differential
GenevisibleiP17706, HS

Family and domain databases

Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR029021, Prot-tyrosine_phosphatase-like
IPR000242, PTPase_domain
IPR012265, Ptpn1/Ptpn2
IPR016130, Tyr_Pase_AS
IPR003595, Tyr_Pase_cat
IPR000387, TYR_PHOSPHATASE_dom
PfamiView protein in Pfam
PF00102, Y_phosphatase, 1 hit
PIRSFiPIRSF000926, Tyr-Ptase_nr1, 1 hit
PRINTSiPR00700, PRTYPHPHTASE
SMARTiView protein in SMART
SM00194, PTPc, 1 hit
SM00404, PTPc_motif, 1 hit
SUPFAMiSSF52799, SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS00383, TYR_PHOSPHATASE_1, 1 hit
PS50056, TYR_PHOSPHATASE_2, 1 hit
PS50055, TYR_PHOSPHATASE_PTP, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPTN2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P17706
Secondary accession number(s): A8K955
, A8MXU3, K7ENG3, Q96AU5, Q96HR2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: May 5, 2009
Last modified: September 29, 2021
This is version 216 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again