Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P17693 (HLAG_HUMAN)

Entry version 201 (10 Feb 2021)
Sequence version 1 (01 Aug 1990)
Previous versions | rss
Add a publicationFeedback
Protein

HLA class I histocompatibility antigen, alpha chain G

Gene

HLA-G

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Non-classical major histocompatibility class Ib molecule involved in immune regulatory processes at the maternal-fetal interface (PubMed:23184984, PubMed:29262349, PubMed:19304799). In complex with B2M/beta-2 microglobulin binds a limited repertoire of nonamer self-peptides derived from intracellular proteins including histones and ribosomal proteins (PubMed:7584149, PubMed:8805247). Peptide-bound HLA-G-B2M complex acts as a ligand for inhibitory/activating KIR2DL4, LILRB1 and LILRB2 receptors on uterine immune cells to promote fetal development while maintaining maternal-fetal tolerance (PubMed:23184984, PubMed:29262349, PubMed:16366734, PubMed:19304799, PubMed:20448110, PubMed:27859042). Upon interaction with KIR2DL4 and LILRB1 receptors on decidual NK cells, it triggers NK cell senescence-associated secretory phenotype as a molecular switch to promote vascular remodeling and fetal growth in early pregnancy (PubMed:23184984, PubMed:29262349, PubMed:16366734, PubMed:19304799). Through interaction with KIR2DL4 receptor on decidual macrophages induces proinflammatory cytokine production mainly associated with tissue remodeling (PubMed:19304799). Through interaction with LILRB2 receptor triggers differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, both of which actively maintain maternal-fetal tolerance (PubMed:20448110, PubMed:27859042). May play a role in balancing tolerance and antiviral-immunity at maternal-fetal interface by keeping in check the effector functions of NK, CD8+ T cells and B cells (PubMed:10190900, PubMed:11290782, PubMed:24453251). Reprograms B cells toward an immune suppressive phenotype via LILRB1 (PubMed:24453251). May induce immune activation/suppression via intercellular membrane transfer (trogocytosis), likely enabling interaction with KIR2DL4, which resides mostly in endosomes (PubMed:20179272, PubMed:26460007). Through interaction with the inhibitory receptor CD160 on endothelial cells may control angiogenesis in immune privileged sites (PubMed:16809620).14 Publications
Likely does not bind B2M and presents peptides. Negatively regulates NK cell- and CD8+ T cell-mediated cytotoxicity (PubMed:11290782).Curated1 Publication
Likely does not bind B2M and presents peptides. Negatively regulates NK cell- and CD8+ T cell-mediated cytotoxicity (PubMed:11290782).Curated1 Publication
Likely does not bind B2M and presents peptides. Negatively regulates NK cell- and CD8+ T cell-mediated cytotoxicity (PubMed:11290782).Curated1 Publication
Non-classical major histocompatibility class Ib molecule involved in immune regulatory processes at the maternal-fetal interface (PubMed:23184984, PubMed:29262349, PubMed:19304799). In complex with B2M/beta-2 microglobulin binds a limited repertoire of nonamer self-peptides derived from intracellular proteins including histones and ribosomal proteins (PubMed:7584149, PubMed:8805247). Peptide-bound HLA-G-B2M complex acts as a ligand for inhibitory/activating KIR2DL4, LILRB1 and LILRB2 receptors on uterine immune cells to promote fetal development while maintaining maternal-fetal tolerance (PubMed:23184984, PubMed:29262349, PubMed:16366734, PubMed:19304799, PubMed:20448110). Upon interaction with KIR2DL4 and LILRB1 receptors on decidual NK cells, it triggers NK cell senescence-associated secretory phenotype as a molecular switch to promote vascular remodeling and fetal growth in early pregnancy (PubMed:23184984, PubMed:29262349, PubMed:16366734, PubMed:19304799). Through interaction with KIR2DL4 receptor on decidual macrophages induces proinflammatory cytokine production mainly associated with tissue remodeling (PubMed:19304799). Through interaction with LILRB2 receptor triggers differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, both of which actively maintain maternal-fetal tolerance (PubMed:20448110). Reprograms B cells toward an immune suppressive phenotype via LILRB1 (PubMed:24453251).8 Publications
Likely does not bind B2M and presents peptides.Curated
Likely does not bind B2M and presents peptides.Curated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei31Self-peptide antigen2 Publications1
Binding sitei94Self-peptide antigen1 Publication1
Binding sitei101Self-peptide antigen1 Publication1
Binding sitei108Self-peptide antigen3 Publications1
Binding sitei167Self-peptide antigen; via carbonyl oxygen3 Publications1
Binding sitei170Self-peptide antigen2 Publications1
Binding sitei179Self-peptide antigen; via carbonyl oxygen1 Publication1
Binding sitei180Self-peptide antigen1 Publication1
Binding sitei183Self-peptide antigen3 Publications1
Binding sitei195Self-peptide antigen4 Publications1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processImmunity

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P17693

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1236974, ER-Phagosome pathway
R-HSA-1236977, Endosomal/Vacuolar pathway
R-HSA-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-877300, Interferon gamma signaling
R-HSA-909733, Interferon alpha/beta signaling
R-HSA-983170, Antigen Presentation: Folding, assembly and peptide loading of class I MHC

SIGNOR Signaling Network Open Resource

More...SIGNORi		P17693

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
HLA class I histocompatibility antigen, alpha chain G
Alternative name(s):
HLA G antigen
MHC class I antigen G
Cleaved into the following chain:
Soluble HLA class I histocompatibility antigen, alpha chain G
Short name:
sHLA-G1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HLA-G1 PublicationImported
Synonyms:HLA-6.0, HLAG
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:4964, HLA-G

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		142871, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P17693

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000204632.11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini25 – 308ExtracellularSequence analysisAdd BLAST284
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei309 – 332HelicalSequence analysisAdd BLAST24
Topological domaini333 – 338CytoplasmicSequence analysis6

Keywords - Cellular componenti

Cell membrane, Cell projection, Endoplasmic reticulum, Endosome, Membrane, MHC I, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi66C → S: Abolishes homodimerization and homotrimerization. Decreases functional interaction with LILRB1. Does not affect homodimerization of isoform 2 and its binding to LILRB2. 3 Publications1
Mutagenesisi138E → H: Enables TAPBP-independent transport to the cell surface. 1 Publication1
Mutagenesisi138E → Q: Decreases TAPBP-dependent transport to the cell surface. 1 Publication1
Mutagenesisi171C → S: Abolishes homodimerization. Decreases functional interaction with LILRB1. 1 Publication1
Mutagenesisi334 – 335KK → AA: Abolishes binding to COPB1 and Golgi-to-ER retrograde transport. 1 Publication2

Organism-specific databases

DisGeNET

More...DisGeNETi		3135

MalaCards human disease database

More...MalaCardsi		HLA-G

Open Targets

More...OpenTargetsi		ENSG00000204632

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA35083

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P17693, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		HLA-G

Domain mapping of disease mutations (DMDM)

More...DMDMi		122132

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 24Add BLAST24
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001888625 – 338HLA class I histocompatibility antigen, alpha chain GAdd BLAST314
ChainiPRO_0000445908? – 338Soluble HLA class I histocompatibility antigen, alpha chain G1 Publication

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi66InterchainPROSITE-ProRule annotation2 Publications
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi110N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi125 ↔ 188PROSITE-ProRule annotation4 Publications
Disulfide bondi171Interchain1 Publication
Disulfide bondi227 ↔ 283PROSITE-ProRule annotation4 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.1 Publication
Produced by proteolytic cleavage at the cell surface (shedding) by matrix metalloproteinase MMP2.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P17693

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P17693

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P17693

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P17693

PeptideAtlas

More...PeptideAtlasi		P17693

PRoteomics IDEntifications database

More...PRIDEi		P17693

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		53506

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P17693, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P17693

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P17693

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P17693

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in adult eye (PubMed:1570318). Expressed in immune cell subsets including monocytes, myeloid and plasmacytoid dendritic cells and regulatory T cells (Tr1)(at protein level) (PubMed:20448110). Secreted by follicular dendritic cell and follicular helper T cells (PubMed:24453251). Isoform 5: Detected in physiological fluids including amniotic fluid and serum (PubMed:11137219). Isoform 7: Expressed in placenta, amniotic membrane, skin cord blood and peripheral blood mononuclear cells (PubMed:11137219).7 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed at the morula stage (at protein level) (PubMed:29262349). Expressed in extravillous trophoblast and cytotrophoblast (PubMed:26460007, PubMed:16210391, PubMed:7589701). Expressed in fetal eye and thymus (PubMed:2336406). Isoform 7: Expressed in fetal liver (PubMed:11137219).3 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by immunosuppressive cytokine IL10 on dendritic cells and CD4+ T cells (PubMed:20448110). Up-regulated by progesterone in cytotrophoblasts (PubMed:16210391).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000204632, Expressed in blood and 240 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P17693, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P17693, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000204632, Tissue enriched (placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms a heterotrimer with B2M and a self-peptide (peptide-bound HLA-G-B2M) (PubMed:7584149, PubMed:8805247). HLA-G-B2M complex interacts with components of the antigen processing machinery TAPBP and TAP1-TAP2 complex; this interaction is required for loading of high affinity peptides and heterotrimer translocation to the cell surface (PubMed:7584149).

Interacts with CALCR; this interaction is required for appropriate folding (PubMed:9640257).

Interacts with COPB1; this interaction mediates the endoplasmic reticulum (ER) retrieval of HLA-G-B2M complexes that bind low affinity peptides (PubMed:11520457, PubMed:12582157). On the cell surface, peptide-bound HLA-G-B2M molecules (referred to as monomers) can form disulfide-linked homomultimers, homodimers and homotrimers (PubMed:12454284, PubMed:12874224, PubMed:16455647).

Interacts with KIR2DL4; this interaction is direct (PubMed:10190900, PubMed:16366734).

Interacts with LILRB1 and LILRB2 receptors; this interaction is direct (PubMed:16455647, PubMed:16366734, PubMed:17056715, PubMed:12853576).

Interacts with CD160; this interactions is direct (PubMed:16809620).

Interacts with CD8A homodimer; this interaction is direct and might down-regulate T cell receptor signaling (PubMed:12853576). Isoform 2:

Forms a non-disulfide-linked homodimer and interacts with LILRB2 (PubMed:28348268).

14 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		109380, 21 interactors

Database of interacting proteins

More...DIPi		DIP-46121N

Protein interaction database and analysis system

More...IntActi		P17693, 15 interactors

Molecular INTeraction database

More...MINTi		P17693

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000412927

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P17693, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1338
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P17693

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P17693

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini209 – 299Ig-like C1-typeAdd BLAST91

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni25 – 114Alpha-1Add BLAST90
Regioni115 – 206Alpha-2Add BLAST92
Regioni207 – 298Alpha-3Add BLAST92
Regioni299 – 308Connecting peptide10

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi334 – 336ER-retrieval signal1 Publication3

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MHC class I family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502RQEK, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00980000198488

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_047501_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P17693

Database for complete collections of gene phylogenies

More...PhylomeDBi		P17693

TreeFam database of animal gene trees

More...TreeFami		TF336617

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 1 hit
3.30.500.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003006, Ig/MHC_CS
IPR003597, Ig_C1-set
IPR011161, MHC_I-like_Ag-recog
IPR037055, MHC_I-like_Ag-recog_sf
IPR011162, MHC_I/II-like_Ag-recog
IPR001039, MHC_I_a_a1/a2

Pfam protein domain database

More...Pfami		View protein in Pfam
PF07654, C1-set, 1 hit
PF00129, MHC_I, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01638, MHCCLASSI

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00407, IGc1, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726, SSF48726, 1 hit
SSF54452, SSF54452, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50835, IG_LIKE, 1 hit
PS00290, IG_MHC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P17693-1) [UniParc]FASTAAdd to basket
Also known as: HLA-G11 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVVMAPRTLF LLLSGALTLT ETWAGSHSMR YFSAAVSRPG RGEPRFIAMG 
        60         70         80         90        100
YVDDTQFVRF DSDSACPRME PRAPWVEQEG PEYWEEETRN TKAHAQTDRM 
       110        120        130        140        150
NLQTLRGYYN QSEASSHTLQ WMIGCDLGSD GRLLRGYEQY AYDGKDYLAL 
       160        170        180        190        200
NEDLRSWTAA DTAAQISKRK CEAANVAEQR RAYLEGTCVE WLHRYLENGK 
       210        220        230        240        250
EMLQRADPPK THVTHHPVFD YEATLRCWAL GFYPAEIILT WQRDGEDQTQ 
       260        270        280        290        300
DVELVETRPA GDGTFQKWAA VVVPSGEEQR YTCHVQHEGL PEPLMLRWKQ 
       310        320        330 
SSLPTIPIMG IVAGLVVLAA VVTGAAVAAV LWRKKSSD
Length:338
Mass (Da):38,224
Last modified:August 1, 1990 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0678E263BE8962FF
GO
Isoform 2 (identifier: P17693-2) [UniParc]FASTAAdd to basket
Also known as: HLA-G21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     115-206: Missing.
     207-207: D → K

Show »
Length:246
Mass (Da):27,694
Checksum:iC9B5A82501274909
GO
Isoform 3 (identifier: P17693-3) [UniParc]FASTAAdd to basket
Also known as: HLA-G31 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     115-298: Missing.

Show »
Length:154
Mass (Da):17,070
Checksum:iCECFCC7616238134
GO
Isoform 4 (identifier: P17693-4) [UniParc]FASTAAdd to basket
Also known as: HLA-G.3-51 Publication, HLA-G41 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     207-298: Missing.

Show »
Length:246
Mass (Da):27,613
Checksum:i257B982E358A94D0
GO
Isoform 5 (identifier: P17693-5) [UniParc]FASTAAdd to basket
Also known as: HLA-G1sol1 Publication, HLA-G51 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     299-338: KQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD → SKEGDGGIMSVRESRSLSEDL

Show »
Length:319
Mass (Da):36,458
Checksum:iA2010B7518A4230B
GO
Isoform 6 (identifier: P17693-6) [UniParc]FASTAAdd to basket
Also known as: HLA-G2sol1 Publication, HLA-G61 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     115-206: Missing.
     207-207: D → K
     299-338: KQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD → SKEGDGGIMSVRESRSLSEDL

Show »
Length:227
Mass (Da):25,928
Checksum:iACB75F53EE9D0AA8
GO
Isoform 7 (identifier: P17693-7) [UniParc]FASTAAdd to basket
Also known as: HLA-G71 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     116-116: S → E
     117-338: Missing.

Show »
Length:116
Mass (Da):13,286
Checksum:iFE98D2D0E1628C31
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5RJ85Q5RJ85_HUMAN
HLA class I histocompatibility anti...
HLA-G hCG_1999524
343Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q31611Q31611_HUMAN
B2 microglobulin
HLA-G HLA-G2.2
246Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q8MH48Q8MH48_HUMAN
HLA class I histocompatibility anti...
HLA-G
338Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JPQ3A0A0G2JPQ3_HUMAN
HLA class I histocompatibility anti...
HLA-G
343Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JNX1A0A0G2JNX1_HUMAN
HLA class I histocompatibility anti...
HLA-G
246Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_059191115 – 298Missing in isoform 3. 1 PublicationAdd BLAST184
Alternative sequenceiVSP_059192115 – 206Missing in isoform 2 and isoform 6. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_059193116S → E in isoform 7. 1 Publication1
Alternative sequenceiVSP_059194117 – 338Missing in isoform 7. 1 PublicationAdd BLAST222
Alternative sequenceiVSP_059196207 – 298Missing in isoform 4. 2 PublicationsAdd BLAST92
Alternative sequenceiVSP_059195207D → K in isoform 2 and isoform 6. 1 Publication1
Alternative sequenceiVSP_059197299 – 338KQSSL…KKSSD → SKEGDGGIMSVRESRSLSED L in isoform 5 and isoform 6. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X17273 mRNA Translation: CAA35174.1
J03027 Genomic DNA Translation: AAA98745.1
M90683 mRNA Translation: AAA52673.1
AF055066 Genomic DNA Translation: AAC24826.1
BA000025 Genomic DNA Translation: BAB63336.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS4668.1 [P17693-1]

Protein sequence database of the Protein Information Resource

More...PIRi		A39953

NCBI Reference Sequences

More...RefSeqi		NP_002118.1, NM_002127.5 [P17693-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000360323; ENSP00000353472; ENSG00000204632 [P17693-1]
ENST00000376815; ENSP00000366011; ENSG00000204632 [P17693-3]
ENST00000383621; ENSP00000373116; ENSG00000206506 [P17693-1]
ENST00000383622; ENSP00000373117; ENSG00000206506 [P17693-3]
ENST00000415687; ENSP00000389969; ENSG00000237216 [P17693-3]
ENST00000423011; ENSP00000389522; ENSG00000233095 [P17693-1]
ENST00000423373; ENSP00000405238; ENSG00000235346 [P17693-1]
ENST00000428701; ENSP00000412927; ENSG00000204632 [P17693-1]
ENST00000428952; ENSP00000388176; ENSG00000235680 [P17693-1]
ENST00000429890; ENSP00000401326; ENSG00000235680 [P17693-3]
ENST00000444098; ENSP00000398200; ENSG00000230413 [P17693-1]
ENST00000445373; ENSP00000416408; ENSG00000230413 [P17693-3]
ENST00000448306; ENSP00000413926; ENSG00000233095 [P17693-3]
ENST00000449127; ENSP00000408773; ENSG00000237216 [P17693-1]
ENST00000457132; ENSP00000410247; ENSG00000235346 [P17693-3]
ENST00000546545; ENSP00000447762; ENSG00000230413 [P17693-1]
ENST00000546634; ENSP00000447780; ENSG00000235346 [P17693-1]
ENST00000547241; ENSP00000448085; ENSG00000233095 [P17693-1]
ENST00000547931; ENSP00000448363; ENSG00000237216 [P17693-1]
ENST00000550897; ENSP00000449903; ENSG00000235680 [P17693-1]
ENST00000553052; ENSP00000449291; ENSG00000206506 [P17693-1]
ENST00000622601; ENSP00000479399; ENSG00000276051 [P17693-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		3135

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:3135

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X17273 mRNA Translation: CAA35174.1
J03027 Genomic DNA Translation: AAA98745.1
M90683 mRNA Translation: AAA52673.1
AF055066 Genomic DNA Translation: AAC24826.1
BA000025 Genomic DNA Translation: BAB63336.1
CCDSiCCDS4668.1 [P17693-1]
PIRiA39953
RefSeqiNP_002118.1, NM_002127.5 [P17693-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1YDPX-ray1.90A26-300[»]
2D31X-ray3.20A/D25-300[»]
2DYPX-ray2.50A25-300[»]
3BZEX-ray2.50P/Q/R/S3-11[»]
3CDGX-ray3.40P/Q3-11[»]
3CIIX-ray4.41C/F3-11[»]
3KYNX-ray2.40A26-299[»]
3KYOX-ray1.70A/C26-298[»]
6AEEX-ray3.30A/D25-300[»]
6K60X-ray3.15A/E25-300[»]
SMRiP17693
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi109380, 21 interactors
DIPiDIP-46121N
IntActiP17693, 15 interactors
MINTiP17693
STRINGi9606.ENSP00000412927

PTM databases

GlyGeniP17693, 1 site
iPTMnetiP17693
PhosphoSitePlusiP17693
SwissPalmiP17693

Genetic variation databases

BioMutaiHLA-G
DMDMi122132

Proteomic databases

EPDiP17693
jPOSTiP17693
MassIVEiP17693
PaxDbiP17693
PeptideAtlasiP17693
PRIDEiP17693
ProteomicsDBi53506

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		P17693, 49 sequenced antibodies

Antibodypedia a portal for validated antibodies

More...Antibodypediai		4253, 1449 antibodies

The DNASU plasmid repository

More...DNASUi		3135

Genome annotation databases

EnsembliENST00000360323; ENSP00000353472; ENSG00000204632 [P17693-1]
ENST00000376815; ENSP00000366011; ENSG00000204632 [P17693-3]
ENST00000383621; ENSP00000373116; ENSG00000206506 [P17693-1]
ENST00000383622; ENSP00000373117; ENSG00000206506 [P17693-3]
ENST00000415687; ENSP00000389969; ENSG00000237216 [P17693-3]
ENST00000423011; ENSP00000389522; ENSG00000233095 [P17693-1]
ENST00000423373; ENSP00000405238; ENSG00000235346 [P17693-1]
ENST00000428701; ENSP00000412927; ENSG00000204632 [P17693-1]
ENST00000428952; ENSP00000388176; ENSG00000235680 [P17693-1]
ENST00000429890; ENSP00000401326; ENSG00000235680 [P17693-3]
ENST00000444098; ENSP00000398200; ENSG00000230413 [P17693-1]
ENST00000445373; ENSP00000416408; ENSG00000230413 [P17693-3]
ENST00000448306; ENSP00000413926; ENSG00000233095 [P17693-3]
ENST00000449127; ENSP00000408773; ENSG00000237216 [P17693-1]
ENST00000457132; ENSP00000410247; ENSG00000235346 [P17693-3]
ENST00000546545; ENSP00000447762; ENSG00000230413 [P17693-1]
ENST00000546634; ENSP00000447780; ENSG00000235346 [P17693-1]
ENST00000547241; ENSP00000448085; ENSG00000233095 [P17693-1]
ENST00000547931; ENSP00000448363; ENSG00000237216 [P17693-1]
ENST00000550897; ENSP00000449903; ENSG00000235680 [P17693-1]
ENST00000553052; ENSP00000449291; ENSG00000206506 [P17693-1]
ENST00000622601; ENSP00000479399; ENSG00000276051 [P17693-3]
GeneIDi3135
KEGGihsa:3135

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3135
DisGeNETi3135

GeneCards: human genes, protein and diseases

More...GeneCardsi		HLA-G
HGNCiHGNC:4964, HLA-G
HPAiENSG00000204632, Tissue enriched (placenta)
MalaCardsiHLA-G
MIMi142871, gene
neXtProtiNX_P17693
OpenTargetsiENSG00000204632
PharmGKBiPA35083
VEuPathDBiHostDB:ENSG00000204632.11

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502RQEK, Eukaryota
GeneTreeiENSGT00980000198488
HOGENOMiCLU_047501_1_1_1
InParanoidiP17693
PhylomeDBiP17693
TreeFamiTF336617

Enzyme and pathway databases

PathwayCommonsiP17693
ReactomeiR-HSA-1236974, ER-Phagosome pathway
R-HSA-1236977, Endosomal/Vacuolar pathway
R-HSA-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-877300, Interferon gamma signaling
R-HSA-909733, Interferon alpha/beta signaling
R-HSA-983170, Antigen Presentation: Folding, assembly and peptide loading of class I MHC
SIGNORiP17693

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		3135, 3 hits in 874 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		HLA-G, human
EvolutionaryTraceiP17693

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		HLA-G

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		3135
PharosiP17693, Tbio

Protein Ontology

More...PROi		PR:P17693
RNActiP17693, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000204632, Expressed in blood and 240 other tissues
ExpressionAtlasiP17693, baseline and differential
GenevisibleiP17693, HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
3.30.500.10, 1 hit
InterProiView protein in InterPro
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003006, Ig/MHC_CS
IPR003597, Ig_C1-set
IPR011161, MHC_I-like_Ag-recog
IPR037055, MHC_I-like_Ag-recog_sf
IPR011162, MHC_I/II-like_Ag-recog
IPR001039, MHC_I_a_a1/a2
PfamiView protein in Pfam
PF07654, C1-set, 1 hit
PF00129, MHC_I, 1 hit
PRINTSiPR01638, MHCCLASSI
SMARTiView protein in SMART
SM00407, IGc1, 1 hit
SUPFAMiSSF48726, SSF48726, 1 hit
SSF54452, SSF54452, 1 hit
PROSITEiView protein in PROSITE
PS50835, IG_LIKE, 1 hit
PS00290, IG_MHC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHLAG_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P17693
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: August 1, 1990
Last modified: February 10, 2021
This is version 201 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again