Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 191 (03 Jul 2019)
Sequence version 1 (01 Aug 1990)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Neuromodulin

Gene

GAP43

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This protein is associated with nerve growth. It is a major component of the motile "growth cones" that form the tips of elongating axons. Plays a role in axonal and dendritic filopodia induction.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding, Developmental protein
Biological processDifferentiation, Growth regulation, Neurogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-373760 L1CAM interactions

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P17677

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P17677

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.71.2.1 the brain acid-soluble protein channel (basp1 channel) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neuromodulin
Alternative name(s):
Axonal membrane protein GAP-43
Growth-associated protein 43
Neural phosphoprotein B-50
pp46
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GAP43
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:4140 GAP43

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
162060 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P17677

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi3 – 4CC → SS: Inhibits axonal and dendritic filopodia formation and reduces dendritic and axonal branching. 1 Publication2

Organism-specific databases

DisGeNET

More...
DisGeNETi
2596

Open Targets

More...
OpenTargetsi
ENSG00000172020

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28553

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GAP43

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001595961 – 238NeuromodulinAdd BLAST238

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi3S-palmitoyl cysteineBy similarity1
Lipidationi4S-palmitoyl cysteineBy similarity1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei41Phosphoserine; by PHK and PKCBy similarity1
Modified residuei151PhosphoserineBy similarity1
Modified residuei153PhosphoserineBy similarity1
Modified residuei154PhosphoserineBy similarity1
Modified residuei181PhosphothreonineBy similarity1
Modified residuei202Phosphoserine; by CK2By similarity1
Modified residuei203Phosphoserine; by CK2By similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated at Ser-41 by PHK. Phosphorylation of this protein by a protein kinase C is specifically correlated with certain forms of synaptic plasticity.
Palmitoylation by ARF6 is essential for plasma membrane association and axonal and dendritic filopodia induction. Deacylated by LYPLA2.

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P17677

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P17677

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P17677

PeptideAtlas

More...
PeptideAtlasi
P17677

PRoteomics IDEntifications database

More...
PRIDEi
P17677

ProteomicsDB human proteome resource

More...
ProteomicsDBi
53504
53505 [P17677-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P17677

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P17677

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P17677

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000172020 Expressed in 165 organ(s), highest expression level in anterior cingulate cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P17677 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P17677 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB004417
HPA013392
HPA015600

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Identified in a complex containing FGFR4, NCAM1, CDH2, PLCG1, FRS2, SRC, SHC1, GAP43 and CTTN. Binds calmodulin with a greater affinity in the absence of Ca2+ than in its presence.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
PRKCDQ056554EBI-1267511,EBI-704279

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108867, 27 interactors

Database of interacting proteins

More...
DIPi
DIP-452N

Protein interaction database and analysis system

More...
IntActi
P17677, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000377372

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P17677

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini31 – 60IQPROSITE-ProRule annotationAdd BLAST30

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 4Important for membrane binding4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the neuromodulin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IVZP Eukaryota
ENOG411256P LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00730000111265

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000013014

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P17677

KEGG Orthology (KO)

More...
KOi
K20041

Identification of Orthologs from Complete Genome Data

More...
OMAi
IPLHALD

Database of Orthologous Groups

More...
OrthoDBi
1531103at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P17677

TreeFam database of animal gene trees

More...
TreeFami
TF333213

Family and domain databases

Database of protein disorder

More...
DisProti
DP00951

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000048 IQ_motif_EF-hand-BS
IPR001422 Neuromodulin
IPR017454 Neuromodulin_C
IPR018947 Neuromodulin_gap-junction_N
IPR033137 Neuromodulin_P_site
IPR018243 Neuromodulin_palmitoyl_site

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00612 IQ, 1 hit
PF06614 Neuromodulin, 1 hit
PF10580 Neuromodulin_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00215 NEUROMODULIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00015 IQ, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50096 IQ, 1 hit
PS00412 NEUROMODULIN_1, 1 hit
PS00413 NEUROMODULIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P17677-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLCCMRRTKQ VEKNDDDQKI EQDGIKPEDK AHKAATKIQA SFRGHITRKK
60 70 80 90 100
LKGEKKDDVQ AAEAEANKKD EAPVADGVEK KGEGTTTAEA APATGSKPDE
110 120 130 140 150
PGKAGETPSE EKKGEGDAAT EQAAPQAPAS SEEKAGSAET ESATKASTDN
160 170 180 190 200
SPSSKAEDAP AKEEPKQADV PAAVTAAAAT TPAAEDAAAK ATAQPPTETG
210 220 230
ESSQAEENIE AVDETKPKES ARQDEGKEEE PEADQEHA
Length:238
Mass (Da):24,803
Last modified:August 1, 1990 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB3536D012A127CC8
GO
Isoform 2 (identifier: P17677-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MLCCMRRTKQ → MTKSCSELCHPALHFLPCLGGLRKNLQRAVRPSPYSLGFLTFWISR

Note: No experimental confirmation available.
Show »
Length:274
Mass (Da):28,766
Checksum:i5FC56C8954970362
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01417259V → I1 PublicationCorresponds to variant dbSNP:rs6291Ensembl.1
Natural variantiVAR_050271162K → E. Corresponds to variant dbSNP:rs11557762Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0427831 – 10MLCCMRRTKQ → MTKSCSELCHPALHFLPCLG GLRKNLQRAVRPSPYSLGFL TFWISR in isoform 2. 1 Publication10

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M25667 mRNA Translation: AAA52516.1
S66541, S66533, S66534 Genomic DNA Translation: AAB28649.1
AY842481 Genomic DNA Translation: AAV88094.1
AK289699 mRNA Translation: BAF82388.1
AK290100 mRNA Translation: BAF82789.1
AC012598 Genomic DNA No translation available.
AC092468 Genomic DNA No translation available.
AC119795 Genomic DNA No translation available.
BC007936 mRNA Translation: AAH07936.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33830.1 [P17677-1]
CCDS46890.1 [P17677-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
I52638

NCBI Reference Sequences

More...
RefSeqi
NP_001123536.1, NM_001130064.1 [P17677-2]
NP_002036.1, NM_002045.3 [P17677-1]
XP_016861617.1, XM_017006128.1 [P17677-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000305124; ENSP00000305010; ENSG00000172020 [P17677-1]
ENST00000393780; ENSP00000377372; ENSG00000172020 [P17677-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2596

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2596

UCSC genome browser

More...
UCSCi
uc003ebr.3 human [P17677-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs
Wikipedia

Gap-43 entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M25667 mRNA Translation: AAA52516.1
S66541, S66533, S66534 Genomic DNA Translation: AAB28649.1
AY842481 Genomic DNA Translation: AAV88094.1
AK289699 mRNA Translation: BAF82388.1
AK290100 mRNA Translation: BAF82789.1
AC012598 Genomic DNA No translation available.
AC092468 Genomic DNA No translation available.
AC119795 Genomic DNA No translation available.
BC007936 mRNA Translation: AAH07936.1
CCDSiCCDS33830.1 [P17677-1]
CCDS46890.1 [P17677-2]
PIRiI52638
RefSeqiNP_001123536.1, NM_001130064.1 [P17677-2]
NP_002036.1, NM_002045.3 [P17677-1]
XP_016861617.1, XM_017006128.1 [P17677-2]

3D structure databases

SMRiP17677
ModBaseiSearch...

Protein-protein interaction databases

BioGridi108867, 27 interactors
DIPiDIP-452N
IntActiP17677, 2 interactors
STRINGi9606.ENSP00000377372

Protein family/group databases

TCDBi1.A.71.2.1 the brain acid-soluble protein channel (basp1 channel) family

PTM databases

iPTMnetiP17677
PhosphoSitePlusiP17677
SwissPalmiP17677

Polymorphism and mutation databases

BioMutaiGAP43

Proteomic databases

EPDiP17677
jPOSTiP17677
PaxDbiP17677
PeptideAtlasiP17677
PRIDEiP17677
ProteomicsDBi53504
53505 [P17677-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
2596
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000305124; ENSP00000305010; ENSG00000172020 [P17677-1]
ENST00000393780; ENSP00000377372; ENSG00000172020 [P17677-2]
GeneIDi2596
KEGGihsa:2596
UCSCiuc003ebr.3 human [P17677-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2596
DisGeNETi2596

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GAP43
HGNCiHGNC:4140 GAP43
HPAiCAB004417
HPA013392
HPA015600
MIMi162060 gene
neXtProtiNX_P17677
OpenTargetsiENSG00000172020
PharmGKBiPA28553

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IVZP Eukaryota
ENOG411256P LUCA
GeneTreeiENSGT00730000111265
HOGENOMiHOG000013014
InParanoidiP17677
KOiK20041
OMAiIPLHALD
OrthoDBi1531103at2759
PhylomeDBiP17677
TreeFamiTF333213

Enzyme and pathway databases

ReactomeiR-HSA-373760 L1CAM interactions
SignaLinkiP17677
SIGNORiP17677

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
GAP43 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Gap-43_protein

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
2596

Protein Ontology

More...
PROi
PR:P17677

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000172020 Expressed in 165 organ(s), highest expression level in anterior cingulate cortex
ExpressionAtlasiP17677 baseline and differential
GenevisibleiP17677 HS

Family and domain databases

DisProtiDP00951
InterProiView protein in InterPro
IPR000048 IQ_motif_EF-hand-BS
IPR001422 Neuromodulin
IPR017454 Neuromodulin_C
IPR018947 Neuromodulin_gap-junction_N
IPR033137 Neuromodulin_P_site
IPR018243 Neuromodulin_palmitoyl_site
PfamiView protein in Pfam
PF00612 IQ, 1 hit
PF06614 Neuromodulin, 1 hit
PF10580 Neuromodulin_N, 1 hit
PRINTSiPR00215 NEUROMODULIN
SMARTiView protein in SMART
SM00015 IQ, 1 hit
PROSITEiView protein in PROSITE
PS50096 IQ, 1 hit
PS00412 NEUROMODULIN_1, 1 hit
PS00413 NEUROMODULIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNEUM_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P17677
Secondary accession number(s): A8K0Y4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: August 1, 1990
Last modified: July 3, 2019
This is version 191 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again