Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Aspartate aminotransferase, cytoplasmic

Gene

GOT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Biosynthesis of L-glutamate from L-aspartate or L-cysteine. Important regulator of levels of glutamate, the major excitatory neurotransmitter of the vertebrate central nervous system. Acts as a scavenger of glutamate in brain neuroprotection. The aspartate aminotransferase activity is involved in hepatic glucose synthesis during development and in adipocyte glyceroneogenesis. Using L-cysteine as substrate, regulates levels of mercaptopyruvate, an important source of hydrogen sulfide. Mercaptopyruvate is converted into H2S via the action of 3-mercaptopyruvate sulfurtransferase (3MST). Hydrogen sulfide is an important synaptic modulator and neuroprotectant in the brain.1 Publication

Miscellaneous

In eukaryotes there are cytoplasmic, mitochondrial and chloroplastic isozymes.
Aspartate aminotransferase activity found to be increased in cerebral spinal fluid (CSF) of patients with Alzheimer disease (PubMed:16039064). Fetal serum levels of the enzyme in the umbilical artery and vein are found to be significantly higher than maternal serum levels (PubMed:22633534).2 Publications

Catalytic activityi

L-aspartate + 2-oxoglutarate = oxaloacetate + L-glutamate.
L-cysteine + 2-oxoglutarate = mercaptopyruvate + L-glutamate.

Cofactori

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei39Aspartate; via amide nitrogen1
Binding sitei141Aspartate1
Binding sitei195Aspartate1
Binding sitei387Aspartate1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionAminotransferase, Transferase
Biological processAmino-acid biosynthesis
LigandPyridoxal phosphate

Enzyme and pathway databases

BioCyciMetaCyc:HS04361-MONOMER
ReactomeiR-HSA-1237112 Methionine salvage pathway
R-HSA-70263 Gluconeogenesis
R-HSA-70614 Amino acid synthesis and interconversion (transamination)
SABIO-RKiP17174
SIGNORiP17174

Names & Taxonomyi

Protein namesi
Recommended name:
Aspartate aminotransferase, cytoplasmic (EC:2.6.1.1, EC:2.6.1.3)
Short name:
cAspAT
Alternative name(s):
Cysteine aminotransferase, cytoplasmic
Cysteine transaminase, cytoplasmic
Short name:
cCAT
Glutamate oxaloacetate transaminase 1
Transaminase A
Gene namesi
Name:GOT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000120053.10
HGNCiHGNC:4432 GOT1
MIMi138180 gene
neXtProtiNX_P17174

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi2805
MalaCardsiGOT1
MIMi614419 phenotype
OpenTargetsiENSG00000120053
PharmGKBiPA28817

Chemistry databases

ChEMBLiCHEMBL2189139
DrugBankiDB00128 L-Aspartic Acid
DB00151 L-Cysteine
DB00142 L-Glutamic Acid
DB04299 Maleic Acid
DB00114 Pyridoxal Phosphate

Polymorphism and mutation databases

BioMutaiGOT1
DMDMi5902703

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00001238792 – 413Aspartate aminotransferase, cytoplasmicAdd BLAST412

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei149PhosphoserineBy similarity1
Modified residuei259N6-(pyridoxal phosphate)lysineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP17174
MaxQBiP17174
PaxDbiP17174
PeptideAtlasiP17174
PRIDEiP17174
ProteomicsDBi53459

2D gel databases

REPRODUCTION-2DPAGEiIPI00219029
UCD-2DPAGEiP17174

PTM databases

iPTMnetiP17174
PhosphoSitePlusiP17174
SwissPalmiP17174

Expressioni

Gene expression databases

BgeeiENSG00000120053 Expressed in 233 organ(s), highest expression level in heart right ventricle
CleanExiHS_GOT1
ExpressionAtlasiP17174 baseline and differential
GenevisibleiP17174 HS

Organism-specific databases

HPAiHPA064532
HPA072629

Interactioni

Subunit structurei

Homodimer.1 Publication

Protein-protein interaction databases

BioGridi109067, 58 interactors
IntActiP17174, 3 interactors
STRINGi9606.ENSP00000359539

Structurei

Secondary structure

1413
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP17174
SMRiP17174
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP17174

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1411 Eukaryota
COG1448 LUCA
GeneTreeiENSGT00390000014081
HOGENOMiHOG000185898
HOVERGENiHBG000951
InParanoidiP17174
KOiK14454
OMAiELFKEWT
OrthoDBiEOG091G06G3
PhylomeDBiP17174
TreeFamiTF314089

Family and domain databases

Gene3Di3.40.640.10, 1 hit
3.90.1150.10, 1 hit
InterProiView protein in InterPro
IPR004839 Aminotransferase_I/II
IPR000796 Asp_trans
IPR004838 NHTrfase_class1_PyrdxlP-BS
IPR015424 PyrdxlP-dep_Trfase
IPR015422 PyrdxlP-dep_Trfase_dom1
IPR015421 PyrdxlP-dep_Trfase_major
PANTHERiPTHR11879 PTHR11879, 1 hit
PfamiView protein in Pfam
PF00155 Aminotran_1_2, 1 hit
PRINTSiPR00799 TRANSAMINASE
SUPFAMiSSF53383 SSF53383, 1 hit
PROSITEiView protein in PROSITE
PS00105 AA_TRANSFER_CLASS_1, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P17174-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPPSVFAEV PQAQPVLVFK LTADFREDPD PRKVNLGVGA YRTDDCHPWV
60 70 80 90 100
LPVVKKVEQK IANDNSLNHE YLPILGLAEF RSCASRLALG DDSPALKEKR
110 120 130 140 150
VGGVQSLGGT GALRIGADFL ARWYNGTNNK NTPVYVSSPT WENHNAVFSA
160 170 180 190 200
AGFKDIRSYR YWDAEKRGLD LQGFLNDLEN APEFSIVVLH ACAHNPTGID
210 220 230 240 250
PTPEQWKQIA SVMKHRFLFP FFDSAYQGFA SGNLERDAWA IRYFVSEGFE
260 270 280 290 300
FFCAQSFSKN FGLYNERVGN LTVVGKEPES ILQVLSQMEK IVRITWSNPP
310 320 330 340 350
AQGARIVAST LSNPELFEEW TGNVKTMADR ILTMRSELRA RLEALKTPGT
360 370 380 390 400
WNHITDQIGM FSFTGLNPKQ VEYLVNEKHI YLLPSGRINV SGLTTKNLDY
410
VATSIHEAVT KIQ
Length:413
Mass (Da):46,248
Last modified:January 23, 2007 - v3
Checksum:i69FE68BF0C045219
GO
Isoform 2 (identifier: P17174-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVG → MQVWSPWKGAMCPRPHKP

Note: No experimental confirmation available.
Show »
Length:392
Mass (Da):44,147
Checksum:i30D3C8E10522C058
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti215H → R AA sequence (PubMed:2241899).Curated1

Polymorphismi

Genetic variations in GOT1 are associated with low serum aspartate aminotransferase and define the aspartate aminotransferase serum level quantitative trait locus 1 (ASTQTL1) [MIMi:614419].1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_067256389Missing Results in markedly diminished enzymatic activity. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0557991 – 39MAPPS…NLGVG → MQVWSPWKGAMCPRPHKP in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M37400 mRNA Translation: AAA35563.1
AF080467
, AF080459, AF080460, AF080461, AF080462, AF080463, AF080464, AF080465, AF080466 Genomic DNA Translation: AAC32851.1
AF052153 mRNA Translation: AAC28622.1
AK301916 mRNA Translation: BAH13585.1
AK312684 mRNA Translation: BAG35564.1
AL391684 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49869.1
BC000498 mRNA Translation: AAH00498.1
CCDSiCCDS7479.1 [P17174-1]
PIRiS13035
S29027
RefSeqiNP_002070.1, NM_002079.2 [P17174-1]
UniGeneiHs.500756

Genome annotation databases

EnsembliENST00000370508; ENSP00000359539; ENSG00000120053 [P17174-1]
GeneIDi2805
KEGGihsa:2805
UCSCiuc001kpr.4 human [P17174-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M37400 mRNA Translation: AAA35563.1
AF080467
, AF080459, AF080460, AF080461, AF080462, AF080463, AF080464, AF080465, AF080466 Genomic DNA Translation: AAC32851.1
AF052153 mRNA Translation: AAC28622.1
AK301916 mRNA Translation: BAH13585.1
AK312684 mRNA Translation: BAG35564.1
AL391684 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49869.1
BC000498 mRNA Translation: AAH00498.1
CCDSiCCDS7479.1 [P17174-1]
PIRiS13035
S29027
RefSeqiNP_002070.1, NM_002079.2 [P17174-1]
UniGeneiHs.500756

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3II0X-ray2.05A/B/C/D14-412[»]
3WZFX-ray2.99A2-413[»]
ProteinModelPortaliP17174
SMRiP17174
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109067, 58 interactors
IntActiP17174, 3 interactors
STRINGi9606.ENSP00000359539

Chemistry databases

ChEMBLiCHEMBL2189139
DrugBankiDB00128 L-Aspartic Acid
DB00151 L-Cysteine
DB00142 L-Glutamic Acid
DB04299 Maleic Acid
DB00114 Pyridoxal Phosphate

PTM databases

iPTMnetiP17174
PhosphoSitePlusiP17174
SwissPalmiP17174

Polymorphism and mutation databases

BioMutaiGOT1
DMDMi5902703

2D gel databases

REPRODUCTION-2DPAGEiIPI00219029
UCD-2DPAGEiP17174

Proteomic databases

EPDiP17174
MaxQBiP17174
PaxDbiP17174
PeptideAtlasiP17174
PRIDEiP17174
ProteomicsDBi53459

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370508; ENSP00000359539; ENSG00000120053 [P17174-1]
GeneIDi2805
KEGGihsa:2805
UCSCiuc001kpr.4 human [P17174-1]

Organism-specific databases

CTDi2805
DisGeNETi2805
EuPathDBiHostDB:ENSG00000120053.10
GeneCardsiGOT1
HGNCiHGNC:4432 GOT1
HPAiHPA064532
HPA072629
MalaCardsiGOT1
MIMi138180 gene
614419 phenotype
neXtProtiNX_P17174
OpenTargetsiENSG00000120053
PharmGKBiPA28817
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1411 Eukaryota
COG1448 LUCA
GeneTreeiENSGT00390000014081
HOGENOMiHOG000185898
HOVERGENiHBG000951
InParanoidiP17174
KOiK14454
OMAiELFKEWT
OrthoDBiEOG091G06G3
PhylomeDBiP17174
TreeFamiTF314089

Enzyme and pathway databases

BioCyciMetaCyc:HS04361-MONOMER
ReactomeiR-HSA-1237112 Methionine salvage pathway
R-HSA-70263 Gluconeogenesis
R-HSA-70614 Amino acid synthesis and interconversion (transamination)
SABIO-RKiP17174
SIGNORiP17174

Miscellaneous databases

ChiTaRSiGOT1 human
EvolutionaryTraceiP17174
GeneWikiiGOT1
GenomeRNAii2805
PROiPR:P17174
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000120053 Expressed in 233 organ(s), highest expression level in heart right ventricle
CleanExiHS_GOT1
ExpressionAtlasiP17174 baseline and differential
GenevisibleiP17174 HS

Family and domain databases

Gene3Di3.40.640.10, 1 hit
3.90.1150.10, 1 hit
InterProiView protein in InterPro
IPR004839 Aminotransferase_I/II
IPR000796 Asp_trans
IPR004838 NHTrfase_class1_PyrdxlP-BS
IPR015424 PyrdxlP-dep_Trfase
IPR015422 PyrdxlP-dep_Trfase_dom1
IPR015421 PyrdxlP-dep_Trfase_major
PANTHERiPTHR11879 PTHR11879, 1 hit
PfamiView protein in Pfam
PF00155 Aminotran_1_2, 1 hit
PRINTSiPR00799 TRANSAMINASE
SUPFAMiSSF53383 SSF53383, 1 hit
PROSITEiView protein in PROSITE
PS00105 AA_TRANSFER_CLASS_1, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiAATC_HUMAN
AccessioniPrimary (citable) accession number: P17174
Secondary accession number(s): B2R6R7, B7Z7E9, Q5VW80
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: January 23, 2007
Last modified: November 7, 2018
This is version 189 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again