Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 164 (08 May 2019)
Sequence version 3 (24 Mar 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Zinc finger protein 17

Gene

ZNF17

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri190 – 212C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri218 – 240C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri246 – 268C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri274 – 296C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri302 – 324C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri358 – 380C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri386 – 408C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri414 – 436C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri442 – 464C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri470 – 492C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri498 – 520C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri526 – 548C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri554 – 576C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri582 – 604C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri610 – 632C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri638 – 660C2H2-type 17PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-212436 Generic Transcription Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 17
Alternative name(s):
Zinc finger protein HPF3
Zinc finger protein KOX10
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF17
Synonyms:KIAA1947, KOX10
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12958 ZNF17

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P17021

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37540

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZNF17

Domain mapping of disease mutations (DMDM)

More...
DMDMi
229485310

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000473391 – 662Zinc finger protein 17Add BLAST662

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P17021

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P17021

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P17021

PeptideAtlas

More...
PeptideAtlasi
P17021

PRoteomics IDEntifications database

More...
PRIDEi
P17021

ProteomicsDB human proteome resource

More...
ProteomicsDBi
53417
53418 [P17021-2]
53419 [P17021-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P17021

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P17021

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000186272 Expressed in 92 organ(s), highest expression level in cerebellum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P17021 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
113396, 2 interactors

Protein interaction database and analysis system

More...
IntActi
P17021, 13 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000471905

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P17021

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini8 – 101KRABPROSITE-ProRule annotationAdd BLAST94

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri190 – 212C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri218 – 240C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri246 – 268C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri274 – 296C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri302 – 324C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri358 – 380C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri386 – 408C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri414 – 436C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri442 – 464C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri470 – 492C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri498 – 520C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri526 – 548C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri554 – 576C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri582 – 604C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri610 – 632C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri638 – 660C2H2-type 17PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000164515

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000234617

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P17021

KEGG Orthology (KO)

More...
KOi
K09228

Identification of Orthologs from Complete Genome Data

More...
OMAi
KPHRDTR

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P17021

TreeFam database of animal gene trees

More...
TreeFami
TF339848

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07765 KRAB_A-box, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 14 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 18 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 9 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 18 hits
PS50157 ZINC_FINGER_C2H2_2, 17 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P17021-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNLTEDYMVF EDVAIHFSQE EWGILNDVQR HLHSDVMLEN FALLSSVGCW
60 70 80 90 100
HGAKDEEAPS KQCVSVGVSQ VTTLKPALST QKAQPCETCS SLLKDILHLA
110 120 130 140 150
EHDGTHPKRT AKLYLHQKEH LREKLTRSDE GRPSFVNDSV HLAKRNLTCM
160 170 180 190 200
QGGKDFTGDS DLQQQALHSG WKPHRDTHGV EAFQSGQNNY SCTQCGKDFC
210 220 230 240 250
HQHTLFEHQK IHTEERPYEC SECGKLFRYN SDLIKHQRNH TGERPYKCSE
260 270 280 290 300
CGKAFSLKYN VVQHQKIHTG ERPYECSECG KAFLRKSHLL QHQRIHTRPR
310 320 330 340 350
PYVCSECGKA FLTQAHLVGH QKIHTGERPY GCNECGKYFM YSSALIRHQK
360 370 380 390 400
VHTGERPFYC CECGKFFMDS CTLIIHQRVH TGEKPYECNE CGKFFRYRST
410 420 430 440 450
LIRHQKVHTG EKPYECSECG KFFMDTSTLI IHQRVHTGEK PYECNKCGKF
460 470 480 490 500
FRYCFTLNRH QRVHSGERPY ECSECGKFFV DSCTLKSHQR VHTGERPFEC
510 520 530 540 550
SICGKSFRCR STLDTHQRIH TGERPYECSE CGKFFRHNSN HIRHRRNHFG
560 570 580 590 600
ERSFECTECG RVFSQNSHLI RHQKVHTRER TYKCSKCGKF FMDSSTLISH
610 620 630 640 650
ERVHTGEKPY ECSECGKVFR YNSSLIKHRR IHTGERPYQC SECGRVFNQN
660
SHLIQHQKVH TR
Length:662
Mass (Da):77,204
Last modified:March 24, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDB91A427566145E0
GO
Isoform 2 (identifier: P17021-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MNLTE → MLMDAGQ

Show »
Length:664
Mass (Da):77,362
Checksum:i474EAF6C0C7AE299
GO
Isoform 3 (identifier: P17021-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: MNLTEDYMVFEDVAIHFSQEEWGILNDVQRHLHSDVMLENFALLSSV → MGLPLPSKVIMHFMSISVL

Show »
Length:634
Mass (Da):73,781
Checksum:iE160A56AA3A043F3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R2T2M0R2T2_HUMAN
Zinc finger protein 17
ZNF17
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QZR3M0QZR3_HUMAN
Zinc finger protein 17
ZNF17
51Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC04956 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC05252 differs from that shown. Reason: Erroneous termination at position 461. Translated as Gln.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti96I → T in BAC05252 (PubMed:14702039).Curated1
Sequence conflicti394F → S in BAG54604 (PubMed:14702039).Curated1
Sequence conflicti552R → G in BAG54682 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057382148T → K. Corresponds to variant dbSNP:rs2014827Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0366521 – 47MNLTE…LLSSV → MGLPLPSKVIMHFMSISVL in isoform 3. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_0366511 – 5MNLTE → MLMDAGQ in isoform 2. 1 Publication5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK097123 mRNA Translation: BAC04956.1 Different initiation.
AK098183 mRNA Translation: BAC05252.1 Sequence problems.
AK127948 mRNA Translation: BAG54604.1
AK128471 mRNA Translation: BAG54682.1
AC003002 Genomic DNA No translation available.
AB075827 mRNA Translation: BAB85533.1
X52341 mRNA Translation: CAA36567.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42636.1 [P17021-1]
CCDS82405.1 [P17021-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
I37949 S10398

NCBI Reference Sequences

More...
RefSeqi
NP_001317546.1, NM_001330617.1 [P17021-2]
NP_008890.2, NM_006959.2 [P17021-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000307658; ENSP00000302455; ENSG00000186272 [P17021-2]
ENST00000601808; ENSP00000471905; ENSG00000186272 [P17021-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7565

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7565

UCSC genome browser

More...
UCSCi
uc002qoo.2 human [P17021-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097123 mRNA Translation: BAC04956.1 Different initiation.
AK098183 mRNA Translation: BAC05252.1 Sequence problems.
AK127948 mRNA Translation: BAG54604.1
AK128471 mRNA Translation: BAG54682.1
AC003002 Genomic DNA No translation available.
AB075827 mRNA Translation: BAB85533.1
X52341 mRNA Translation: CAA36567.1
CCDSiCCDS42636.1 [P17021-1]
CCDS82405.1 [P17021-2]
PIRiI37949 S10398
RefSeqiNP_001317546.1, NM_001330617.1 [P17021-2]
NP_008890.2, NM_006959.2 [P17021-1]

3D structure databases

SMRiP17021
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113396, 2 interactors
IntActiP17021, 13 interactors
STRINGi9606.ENSP00000471905

PTM databases

iPTMnetiP17021
PhosphoSitePlusiP17021

Polymorphism and mutation databases

BioMutaiZNF17
DMDMi229485310

Proteomic databases

EPDiP17021
MaxQBiP17021
PaxDbiP17021
PeptideAtlasiP17021
PRIDEiP17021
ProteomicsDBi53417
53418 [P17021-2]
53419 [P17021-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
7565
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000307658; ENSP00000302455; ENSG00000186272 [P17021-2]
ENST00000601808; ENSP00000471905; ENSG00000186272 [P17021-1]
GeneIDi7565
KEGGihsa:7565
UCSCiuc002qoo.2 human [P17021-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7565

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZNF17
HGNCiHGNC:12958 ZNF17
neXtProtiNX_P17021
PharmGKBiPA37540

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000164515
HOGENOMiHOG000234617
InParanoidiP17021
KOiK09228
OMAiKPHRDTR
OrthoDBi1318335at2759
PhylomeDBiP17021
TreeFamiTF339848

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7565

Protein Ontology

More...
PROi
PR:P17021

Gene expression databases

BgeeiENSG00000186272 Expressed in 92 organ(s), highest expression level in cerebellum
ExpressionAtlasiP17021 baseline and differential

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 14 hits
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 18 hits
SUPFAMiSSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 9 hits
PROSITEiView protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 18 hits
PS50157 ZINC_FINGER_C2H2_2, 17 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZNF17_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P17021
Secondary accession number(s): B3KXU2
, B3KY20, Q8N7M1, Q8N893, Q8TF54
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: March 24, 2009
Last modified: May 8, 2019
This is version 164 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again