Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 189 (18 Sep 2019)
Sequence version 2 (05 Jul 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc finger X-chromosomal protein

Gene

ZFX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable transcriptional activator.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri425 – 447C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri456 – 478C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri488 – 510C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri519 – 542C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri548 – 570C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri576 – 599C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri605 – 627C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri633 – 656C2H2-type 8PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri662 – 684C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri690 – 713C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri719 – 741C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri747 – 770C2H2-type 12PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri776 – 798C2H2-type 13PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger X-chromosomal protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZFX
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12869 ZFX

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
314980 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P17010

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
7543

Open Targets

More...
OpenTargetsi
ENSG00000005889

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37458

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZFX

Domain mapping of disease mutations (DMDM)

More...
DMDMi
68844748

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000472581 – 805Zinc finger X-chromosomal proteinAdd BLAST805

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei274PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P17010

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P17010

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P17010

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P17010

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P17010

PeptideAtlas

More...
PeptideAtlasi
P17010

PRoteomics IDEntifications database

More...
PRIDEi
P17010

ProteomicsDB human proteome resource

More...
ProteomicsDBi
53407 [P17010-1]
53408 [P17010-2]
7522

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P17010

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P17010

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000005889 Expressed in 213 organ(s), highest expression level in kidney

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P17010 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P17010 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA001748
HPA003877
HPA071863

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
113375, 6 interactors

Database of interacting proteins

More...
DIPi
DIP-62116N

Protein interaction database and analysis system

More...
IntActi
P17010, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000368475

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri425 – 447C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri456 – 478C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri488 – 510C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri519 – 542C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri548 – 570C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri576 – 599C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri605 – 627C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri633 – 656C2H2-type 8PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri662 – 684C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri690 – 713C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri719 – 741C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri747 – 770C2H2-type 12PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri776 – 798C2H2-type 13PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158684

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P17010

Identification of Orthologs from Complete Genome Data

More...
OMAi
HVVHDNV

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P17010

TreeFam database of animal gene trees

More...
TreeFami
TF335557

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006794 Transcrp_activ_Zfx/Zfy-dom
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096 zf-C2H2, 7 hits
PF04704 Zfx_Zfy_act, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 13 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 7 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 8 hits
PS50157 ZINC_FINGER_C2H2_2, 13 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P17010-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDEDGLELQQ EPNSFFDATG ADGTHMDGDQ IVVEVQETVF VSDVVDSDIT
60 70 80 90 100
VHNFVPDDPD SVVIQDVIED VVIEDVQCPD IMEEADVSET VIIPEQVLDS
110 120 130 140 150
DVTEEVSLAH CTVPDDVLAS DITSASMSMP EHVLTGDSIH VSDVGHVGHV
160 170 180 190 200
GHVEHVVHDS VVEAEIVTDP LTTDVVSEEV LVADCASEAV IDANGIPVDQ
210 220 230 240 250
QDDDKGNCED YLMISLDDAG KIEHDGSSGM TMDTESEIDP CKVDGTCPEV
260 270 280 290 300
IKVYIFKADP GEDDLGGTVD IVESEPENDH GVELLDQNSS IRVPREKMVY
310 320 330 340 350
MTVNDSQPED EDLNVAEIAD EVYMEVIVGE EDAAAAAAAA AVHEQQMDDN
360 370 380 390 400
EIKTFMPIAW AAAYGNNSDG IENRNGTASA LLHIDESAGL GRLAKQKPKK
410 420 430 440 450
RRRPDSRQYQ TAIIIGPDGH PLTVYPCMIC GKKFKSRGFL KRHMKNHPEH
460 470 480 490 500
LAKKKYRCTD CDYTTNKKIS LHNHLESHKL TSKAEKAIEC DECGKHFSHA
510 520 530 540 550
GALFTHKMVH KEKGANKMHK CKFCEYETAE QGLLNRHLLA VHSKNFPHIC
560 570 580 590 600
VECGKGFRHP SELKKHMRIH TGEKPYQCQY CEYRSADSSN LKTHVKTKHS
610 620 630 640 650
KEMPFKCDIC LLTFSDTKEV QQHALIHQES KTHQCLHCDH KSSNSSDLKR
660 670 680 690 700
HIISVHTKDY PHKCDMCDKG FHRPSELKKH VAAHKGKKMH QCRHCDFKIA
710 720 730 740 750
DPFVLSRHIL SVHTKDLPFR CKRCRKGFRQ QSELKKHMKT HSGRKVYQCE
760 770 780 790 800
YCEYSTTDAS GFKRHVISIH TKDYPHRCEY CKKGFRRPSE KNQHIMRHHK

EVGLP
Length:805
Mass (Da):90,522
Last modified:July 5, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB074079D1762A0AD
GO
Isoform 2 (identifier: P17010-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-229: Missing.

Show »
Length:576
Mass (Da):66,065
Checksum:i090B0224004324E0
GO
Isoform 3 (identifier: P17010-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TDRVSFCHPGWSTVAPSGSTATSASQAQVICSASRVTGAT

Note: No experimental confirmation available.
Show »
Length:844
Mass (Da):94,386
Checksum:i2A04EEF5202B8595
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PEP7E9PEP7_HUMAN
Zinc finger X-chromosomal protein
ZFX
755Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J682C9J682_HUMAN
Zinc finger X-chromosomal protein
ZFX
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JGU9C9JGU9_HUMAN
Zinc finger X-chromosomal protein
ZFX
31Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti337 – 341AAAAA → GHAP in CAA42416 (PubMed:2512506).Curated5
Sequence conflicti337 – 341AAAAA → GHAP in CAA42417 (PubMed:2512506).Curated5
Sequence conflicti337A → R in AAA61309 (PubMed:2308929).Curated1
Sequence conflicti558R → S (PubMed:2041734).Curated1
Sequence conflicti634Missing (PubMed:2041734).Curated1
Sequence conflicti683A → R (PubMed:2041734).Curated1
Sequence conflicti771T → R (PubMed:2041734).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0143711 – 229Missing in isoform 2. 1 PublicationAdd BLAST229
Alternative sequenceiVSP_05451219T → TDRVSFCHPGWSTVAPSGST ATSASQAQVICSASRVTGAT in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X59738 mRNA Translation: CAA42416.1
X59739 mRNA Translation: CAA42417.1
X59740 mRNA Translation: CAA42418.1
M30608 mRNA Translation: AAA61309.1
AC002404 Genomic DNA No translation available.
BC136309 mRNA Translation: AAI36310.1
AH005875 Genomic DNA Translation: AAL62492.1
AF045781 Genomic DNA Translation: AAC03062.2
M26946 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14211.1 [P17010-1]
CCDS55390.1 [P17010-2]
CCDS83461.1 [P17010-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
B35047

NCBI Reference Sequences

More...
RefSeqi
NP_001171555.1, NM_001178084.1 [P17010-1]
NP_001171556.1, NM_001178085.1 [P17010-1]
NP_001171557.1, NM_001178086.1 [P17010-2]
NP_001317256.1, NM_001330327.1 [P17010-3]
NP_003401.2, NM_003410.3 [P17010-1]
XP_005274648.1, XM_005274591.4 [P17010-1]
XP_005274649.1, XM_005274592.3 [P17010-1]
XP_006724576.1, XM_006724513.3 [P17010-3]
XP_011543881.1, XM_011545579.1 [P17010-1]
XP_011543883.1, XM_011545581.2 [P17010-1]
XP_016885277.1, XM_017029788.1 [P17010-3]
XP_016885278.1, XM_017029789.1 [P17010-3]
XP_016885279.1, XM_017029790.1 [P17010-3]
XP_016885280.1, XM_017029791.1 [P17010-3]
XP_016885281.1, XM_017029792.1 [P17010-3]
XP_016885282.1, XM_017029793.1 [P17010-3]
XP_016885283.1, XM_017029794.1 [P17010-1]
XP_016885284.1, XM_017029795.1 [P17010-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000304543; ENSP00000304985; ENSG00000005889 [P17010-1]
ENST00000379177; ENSP00000368475; ENSG00000005889 [P17010-1]
ENST00000379188; ENSP00000368486; ENSG00000005889 [P17010-3]
ENST00000539115; ENSP00000438233; ENSG00000005889 [P17010-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7543

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7543

UCSC genome browser

More...
UCSCi
uc004dbd.3 human [P17010-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X59738 mRNA Translation: CAA42416.1
X59739 mRNA Translation: CAA42417.1
X59740 mRNA Translation: CAA42418.1
M30608 mRNA Translation: AAA61309.1
AC002404 Genomic DNA No translation available.
BC136309 mRNA Translation: AAI36310.1
AH005875 Genomic DNA Translation: AAL62492.1
AF045781 Genomic DNA Translation: AAC03062.2
M26946 Genomic DNA No translation available.
CCDSiCCDS14211.1 [P17010-1]
CCDS55390.1 [P17010-2]
CCDS83461.1 [P17010-3]
PIRiB35047
RefSeqiNP_001171555.1, NM_001178084.1 [P17010-1]
NP_001171556.1, NM_001178085.1 [P17010-1]
NP_001171557.1, NM_001178086.1 [P17010-2]
NP_001317256.1, NM_001330327.1 [P17010-3]
NP_003401.2, NM_003410.3 [P17010-1]
XP_005274648.1, XM_005274591.4 [P17010-1]
XP_005274649.1, XM_005274592.3 [P17010-1]
XP_006724576.1, XM_006724513.3 [P17010-3]
XP_011543881.1, XM_011545579.1 [P17010-1]
XP_011543883.1, XM_011545581.2 [P17010-1]
XP_016885277.1, XM_017029788.1 [P17010-3]
XP_016885278.1, XM_017029789.1 [P17010-3]
XP_016885279.1, XM_017029790.1 [P17010-3]
XP_016885280.1, XM_017029791.1 [P17010-3]
XP_016885281.1, XM_017029792.1 [P17010-3]
XP_016885282.1, XM_017029793.1 [P17010-3]
XP_016885283.1, XM_017029794.1 [P17010-1]
XP_016885284.1, XM_017029795.1 [P17010-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi113375, 6 interactors
DIPiDIP-62116N
IntActiP17010, 5 interactors
STRINGi9606.ENSP00000368475

PTM databases

iPTMnetiP17010
PhosphoSitePlusiP17010

Polymorphism and mutation databases

BioMutaiZFX
DMDMi68844748

Proteomic databases

EPDiP17010
jPOSTiP17010
MassIVEiP17010
MaxQBiP17010
PaxDbiP17010
PeptideAtlasiP17010
PRIDEiP17010
ProteomicsDBi53407 [P17010-1]
53408 [P17010-2]
7522

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304543; ENSP00000304985; ENSG00000005889 [P17010-1]
ENST00000379177; ENSP00000368475; ENSG00000005889 [P17010-1]
ENST00000379188; ENSP00000368486; ENSG00000005889 [P17010-3]
ENST00000539115; ENSP00000438233; ENSG00000005889 [P17010-2]
GeneIDi7543
KEGGihsa:7543
UCSCiuc004dbd.3 human [P17010-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7543
DisGeNETi7543

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZFX
HGNCiHGNC:12869 ZFX
HPAiHPA001748
HPA003877
HPA071863
MIMi314980 gene
neXtProtiNX_P17010
OpenTargetsiENSG00000005889
PharmGKBiPA37458

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000158684
InParanoidiP17010
OMAiHVVHDNV
OrthoDBi1318335at2759
PhylomeDBiP17010
TreeFamiTF335557

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZFX human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ZFX

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7543

Pharos

More...
Pharosi
P17010

Protein Ontology

More...
PROi
PR:P17010

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000005889 Expressed in 213 organ(s), highest expression level in kidney
ExpressionAtlasiP17010 baseline and differential
GenevisibleiP17010 HS

Family and domain databases

InterProiView protein in InterPro
IPR006794 Transcrp_activ_Zfx/Zfy-dom
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 7 hits
PF04704 Zfx_Zfy_act, 1 hit
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 13 hits
SUPFAMiSSF57667 SSF57667, 7 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 8 hits
PS50157 ZINC_FINGER_C2H2_2, 13 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZFX_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P17010
Secondary accession number(s): B9EG97, O43668, Q8WYJ8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: July 5, 2005
Last modified: September 18, 2019
This is version 189 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again