Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - P16951 (ATF2_MOUSE)

Entry version 201 (23 Feb 2022)
Sequence version 2 (30 May 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Cyclic AMP-dependent transcription factor ATF-2

Gene

Atf2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional activator which regulates the transcription of various genes, including those involved in anti-apoptosis, cell growth, and DNA damage response. Dependent on its binding partner, binds to CRE (cAMP response element) consensus sequences (5'-TGACGTCA-3') or to AP-1 (activator protein 1) consensus sequences (5'-TGACTCA-3'). In the nucleus, contributes to global transcription and the DNA damage response, in addition to specific transcriptional activities that are related to cell development, proliferation and death. In the cytoplasm, interacts with and perturbs HK1- and VDAC1-containing complexes at the mitochondrial outer membrane, thereby impairing mitochondrial membrane potential, inducing mitochondrial leakage and promoting cell death. The phosphorylated form (mediated by ATM) plays a role in the DNA damage response and is involved in the ionizing radiation (IR)-induced S phase checkpoint control and in the recruitment of the MRN complex into the IR-induced foci (IRIF). Exhibits histone acetyltransferase (HAT) activity which specifically acetylates histones H2B and H4 in vitro. In concert with CUL3 and RBX1, promotes the degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM. Can elicit oncogenic or tumor suppressor activities depending on the tissue or cell type (By similarity).

By similarity

Caution

Appears to have histone acetyltransferase (HAT) activity, specifically towards histones H2B and H4 in vitro (By similarity). However, it is not clear if this activity is genuine or caused by contamination with other histone acetyltransferases in the assay.By similarityCurated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri7 – 31C2H2-typePROSITE-ProRule annotationAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processDNA damage, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-3214847, HATs acetylate histones
R-MMU-450341, Activation of the AP-1 family of transcription factors
R-MMU-9018519, Estrogen-dependent gene expression

Protein family/group databases

MoonProt database of moonlighting proteins

More...MoonProti		P16951

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cyclic AMP-dependent transcription factor ATF-2
Short name:
cAMP-dependent transcription factor ATF-2
Alternative name(s):
Activating transcription factor 2
MXBP protein
cAMP response element-binding protein CRE-BP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Atf2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:109349, Atf2

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSMUSG00000027104

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Membrane, Mitochondrion, Mitochondrion outer membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL2176797

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000765781 – 487Cyclic AMP-dependent transcription factor ATF-2Add BLAST487

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei34Phosphothreonine; by PKC/PRKCHBy similarity1
Modified residuei44PhosphoserineCombined sources1
Modified residuei51Phosphothreonine; by MAPK11 and MAPK14Combined sources1
Modified residuei53Phosphothreonine; by MAPK1, MAPK3, MAPK11, MAPK12, MAPK14 and PLK3Combined sources1
Modified residuei55Phosphothreonine; by VRK1By similarity1
Modified residuei72PhosphoserineCombined sources1
Modified residuei94PhosphoserineCombined sources1
Modified residuei98PhosphothreonineBy similarity1
Modified residuei103Phosphoserine; by PKC/PRKCA and PKC/PRKCBBy similarity1
Modified residuei118PhosphoserineBy similarity1
Modified residuei310PhosphoserineBy similarity1
Modified residuei322Phosphoserine; by PKC/PRKCA and PKC/PRKCBBy similarity1
Modified residuei339N6-acetyllysineBy similarity1
Modified residuei349Phosphoserine; by PKC/PRKCA and PKC/PRKCBBy similarity1
Modified residuei356N6-acetyllysineBy similarity1
Modified residuei424PhosphoserineBy similarity1
Modified residuei428PhosphoserineBy similarity1
Modified residuei472Phosphoserine; by ATMBy similarity1
Modified residuei480Phosphoserine; by ATMBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation of Thr-51 by MAPK14 and MAPK11, and at Thr-53 by MAPK1/ERK2, MAPK3/ERK1, MAPK11, MAPK12 and MAPK14 in response to external stimulus like insulin causes increased transcriptional activity. Phosphorylated by PLK3 following hyperosmotic stress. Also phosphorylated and activated by JNK and CaMK4. ATM-mediated phosphorylation at Ser-472 and Ser-480 stimulates its function in DNA damage response. Phosphorylation at Ser-44, Thr-55 and Ser-103 activates its transcriptional activity. Phosphorylation at Thr-51 or Thr-53 enhances acetylation of histones H2B and H4.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P16951

MaxQB - The MaxQuant DataBase

More...MaxQBi		P16951

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P16951

PeptideAtlas

More...PeptideAtlasi		P16951

PRoteomics IDEntifications database

More...PRIDEi		P16951

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		265142 [P16951-1]
265143 [P16951-2]
265144 [P16951-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P16951

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P16951

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000027104, Expressed in paraventricular nucleus of hypothalamus and 334 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P16951, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P16951, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds DNA as a dimer and can form a homodimer in the absence of DNA. Can form a heterodimer with JUN. Heterodimerization is essential for its transcriptional activity.

Interacts with SMAD3 and SMAD4.

Interacts with the HK1/VDAC1 complex.

Interacts with NBN, MRE11, XPO1, KAT5 and CUL3 (By similarity). Binds through its N-terminal region to UTF1 which acts as a coactivator of ATF2 transcriptional activity.

By similarity1 Publication

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		198233, 15 interactors

Protein interaction database and analysis system

More...IntActi		P16951, 5 interactors

Molecular INTeraction database

More...MINTi		P16951

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000107641

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P16951, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		P16951

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P16951

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini334 – 397bZIPPROSITE-ProRule annotationAdd BLAST64

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni106 – 137DisorderedSequence analysisAdd BLAST32
Regioni241 – 355DisorderedSequence analysisAdd BLAST115
Regioni278 – 281Essential for its histone acetyltransferase activityBy similarity4
Regioni336 – 356Basic motifPROSITE-ProRule annotationAdd BLAST21
Regioni362 – 390Leucine-zipperPROSITE-ProRule annotationAdd BLAST29
Regioni407 – 453DisorderedSequence analysisAdd BLAST47

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi387 – 396Nuclear export signalBy similarity10

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi282 – 324Polar residuesSequence analysisAdd BLAST43
Compositional biasi325 – 348Basic and acidic residuesSequence analysisAdd BLAST24
Compositional biasi424 – 453Polar residuesSequence analysisAdd BLAST30

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the bZIP family. ATF subfamily.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri7 – 31C2H2-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1414, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156582

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_021564_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P16951

Identification of Orthologs from Complete Genome Data

More...OMAi		IGKCEEV

Database for complete collections of gene phylogenies

More...PhylomeDBi		P16951

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR029836, ATF2
IPR004827, bZIP
IPR016378, TF_CRE-BP1-typ
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type

The PANTHER Classification System

More...PANTHERi		PTHR19304:SF9, PTHR19304:SF9, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00170, bZIP_1, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF003153, ATF2_CRE-BP1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00338, BRLZ, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57667, SSF57667, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50217, BZIP, 1 hit
PS00036, BZIP_BASIC, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 1 hit
PS50157, ZINC_FINGER_C2H2_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P16951-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDDKPFLCT APGCGQRFTN EDHLAVHKHK HEMTLKFGPA RNDSVIVADQ 
        60         70         80         90        100
TPTPTRFLKN CEEVGLFNEL ASPFENEFKK ASEDDIKKMP LDLSPLATPI 
       110        120        130        140        150
IRSKIEEPSV VETTHQDSPL PHPESTTSDE KEVPLAQTAQ PTSAIVRPAS 
       160        170        180        190        200
LQVPNVLLTS SDSSVIIQQA VPSPTSSTVI TQAPSSNRPI VPVPGPFPLL 
       210        220        230        240        250
LHLPNGQTMP VAIPASITSS NVHVPAAVPL VRPVTMVPSV PGIPGPSSPQ 
       260        270        280        290        300
PVQSEAKMRL KAALTQQHPP VTNGDTVKGH GSGLVRTQSE ESRPQSLQQP 
       310        320        330        340        350
ATSTTETPAS PAHTTPQTQN TSGRRRRAAN EDPDEKRRKF LERNRAAASR 
       360        370        380        390        400
CRQKRKVWVQ SLEKKAEDLS SLNGQLQSEV TLLRNEVAQL KQLLLAHKDC 
       410        420        430        440        450
PVTAMQKKSG YHTADKDDSS EDLSVPSSPH TEAIQHSSVS TSNGVSSTSK 
       460        470        480 
AEAVATSVLT QMADQSTEPA LSQIVMAPPS QAQPSGS
Length:487
Mass (Da):52,298
Last modified:May 30, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF9CDEC3BC3119ACB
GO
Isoform 2 (identifier: P16951-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     132-229: Missing.

Show »
Length:389
Mass (Da):42,345
Checksum:i770AD65EA6114F10
GO
Isoform 3 (identifier: P16951-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVA → MHCPWVWP

Show »
Length:447
Mass (Da):48,002
Checksum:i35A0751C1627D682
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3UXC3G3UXC3_MOUSE
Cyclic AMP-dependent transcription ...
Atf2
377Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6Z2B2F6Z2B2_MOUSE
Cyclic AMP-dependent transcription ...
Atf2
212Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AQE9A2AQE9_MOUSE
Cyclic AMP-dependent transcription ...
Atf2
207Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AQF0A2AQF0_MOUSE
Cyclic AMP-dependent transcription ...
Atf2
228Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AQF1A2AQF1_MOUSE
Cyclic AMP-dependent transcription ...
Atf2
146Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB21128 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAB21129 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti482 – 487AQPSGS → HSPQEVD in AAB21128 (PubMed:11471062).Curated6
Sequence conflicti482 – 487AQPSGS → HSPQEVD in AAB21129 (PubMed:11471062).Curated6

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0005891 – 48MSDDK…SVIVA → MHCPWVWP in isoform 3. CuratedAdd BLAST48
Alternative sequenceiVSP_000590132 – 229Missing in isoform 2. CuratedAdd BLAST98

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF483482 mRNA Translation: AAL90756.1
AF483483 mRNA Translation: AAL90757.1
S76657 mRNA Translation: AAB21128.1 Different initiation.
S76659 mRNA Translation: AAB21129.1 Different initiation.
S76655 mRNA Translation: AAB21127.1
M31629 mRNA Translation: AAA39780.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS16134.1 [P16951-1]
CCDS16135.1 [P16951-3]
CCDS71076.1 [P16951-2]

Protein sequence database of the Protein Information Resource

More...PIRi		A42026
C42026

NCBI Reference Sequences

More...RefSeqi		NP_001020264.1, NM_001025093.2 [P16951-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000055833; ENSMUSP00000058521; ENSMUSG00000027104 [P16951-1]
ENSMUST00000090802; ENSMUSP00000088311; ENSMUSG00000027104 [P16951-3]
ENSMUST00000100009; ENSMUSP00000097588; ENSMUSG00000027104 [P16951-1]
ENSMUST00000112007; ENSMUSP00000107638; ENSMUSG00000027104 [P16951-3]
ENSMUST00000112010; ENSMUSP00000107641; ENSMUSG00000027104 [P16951-3]
ENSMUST00000112016; ENSMUSP00000107647; ENSMUSG00000027104 [P16951-2]
ENSMUST00000112017; ENSMUSP00000107648; ENSMUSG00000027104 [P16951-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		11909

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:11909

UCSC genome browser

More...UCSCi		uc008kdd.2, mouse [P16951-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF483482 mRNA Translation: AAL90756.1
AF483483 mRNA Translation: AAL90757.1
S76657 mRNA Translation: AAB21128.1 Different initiation.
S76659 mRNA Translation: AAB21129.1 Different initiation.
S76655 mRNA Translation: AAB21127.1
M31629 mRNA Translation: AAA39780.1
CCDSiCCDS16134.1 [P16951-1]
CCDS16135.1 [P16951-3]
CCDS71076.1 [P16951-2]
PIRiA42026
C42026
RefSeqiNP_001020264.1, NM_001025093.2 [P16951-1]

3D structure databases

BMRBiP16951
SMRiP16951
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi198233, 15 interactors
IntActiP16951, 5 interactors
MINTiP16951
STRINGi10090.ENSMUSP00000107641

Chemistry databases

ChEMBLiCHEMBL2176797

Protein family/group databases

MoonProtiP16951

PTM databases

iPTMnetiP16951
PhosphoSitePlusiP16951

Proteomic databases

jPOSTiP16951
MaxQBiP16951
PaxDbiP16951
PeptideAtlasiP16951
PRIDEiP16951
ProteomicsDBi265142 [P16951-1]
265143 [P16951-2]
265144 [P16951-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3529, 2535 antibodies from 51 providers

The DNASU plasmid repository

More...DNASUi		11909

Genome annotation databases

EnsembliENSMUST00000055833; ENSMUSP00000058521; ENSMUSG00000027104 [P16951-1]
ENSMUST00000090802; ENSMUSP00000088311; ENSMUSG00000027104 [P16951-3]
ENSMUST00000100009; ENSMUSP00000097588; ENSMUSG00000027104 [P16951-1]
ENSMUST00000112007; ENSMUSP00000107638; ENSMUSG00000027104 [P16951-3]
ENSMUST00000112010; ENSMUSP00000107641; ENSMUSG00000027104 [P16951-3]
ENSMUST00000112016; ENSMUSP00000107647; ENSMUSG00000027104 [P16951-2]
ENSMUST00000112017; ENSMUSP00000107648; ENSMUSG00000027104 [P16951-1]
GeneIDi11909
KEGGimmu:11909
UCSCiuc008kdd.2, mouse [P16951-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		1386
MGIiMGI:109349, Atf2
VEuPathDBiHostDB:ENSMUSG00000027104

Phylogenomic databases

eggNOGiKOG1414, Eukaryota
GeneTreeiENSGT00940000156582
HOGENOMiCLU_021564_0_0_1
InParanoidiP16951
OMAiIGKCEEV
PhylomeDBiP16951

Enzyme and pathway databases

ReactomeiR-MMU-3214847, HATs acetylate histones
R-MMU-450341, Activation of the AP-1 family of transcription factors
R-MMU-9018519, Estrogen-dependent gene expression

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		11909, 1 hit in 67 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Atf2, mouse

Protein Ontology

More...PROi		PR:P16951
RNActiP16951, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000027104, Expressed in paraventricular nucleus of hypothalamus and 334 other tissues
ExpressionAtlasiP16951, baseline and differential
GenevisibleiP16951, MM

Family and domain databases

InterProiView protein in InterPro
IPR029836, ATF2
IPR004827, bZIP
IPR016378, TF_CRE-BP1-typ
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type
PANTHERiPTHR19304:SF9, PTHR19304:SF9, 1 hit
PfamiView protein in Pfam
PF00170, bZIP_1, 1 hit
PIRSFiPIRSF003153, ATF2_CRE-BP1, 1 hit
SMARTiView protein in SMART
SM00338, BRLZ, 1 hit
SUPFAMiSSF57667, SSF57667, 1 hit
PROSITEiView protein in PROSITE
PS50217, BZIP, 1 hit
PS00036, BZIP_BASIC, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 1 hit
PS50157, ZINC_FINGER_C2H2_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiATF2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P16951
Secondary accession number(s): Q64089, Q64090, Q64091
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: May 30, 2000
Last modified: February 23, 2022
This is version 201 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again