STMN1

Functionⁱ

Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear (By similarity).By similarity

GO - Molecular functionⁱ

tubulin binding
Source: MGI
Inferred from direct assayⁱ
- 10675326

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

axonogenesis Source: Ensembl
brain development Source: Ensembl
establishment of skin barrier
Source: CAFA
Inferred from mutant phenotypeⁱ
- 25198505
hepatocyte growth factor receptor signaling pathway
Source: CAFA
Inferred from mutant phenotypeⁱ
- 25198505
intracellular signal transduction
Source: ProtInc
Traceable author statementⁱ
- 2917975
microtubule depolymerization
Source: MGI
Inferred from direct assayⁱ
- 9880330
mitotic cytokinesis
Source: GO_Central
Inferred from mutant phenotypeⁱ
- 25122120
mitotic spindle organization
Source: MGI
Inferred from direct assayⁱ
- 9271428
negative regulation of guanyl-nucleotide exchange factor activity
Source: CAFA
Inferred from mutant phenotypeⁱ
- 25198505
negative regulation of microtubule polymerization
Source: CAFA
Inferred from mutant phenotypeⁱ
- 25198505
negative regulation of Rho protein signal transduction
Source: CAFA
Inferred from mutant phenotypeⁱ
- 25198505
negative regulation of stress fiber assembly
Source: CAFA
Inferred from mutant phenotypeⁱ
- 25198505
negative regulation of thrombin-activated receptor signaling pathway
Source: CAFA
Inferred from mutant phenotypeⁱ
- 25198505
neuron projection development Source: GO_Central
positive regulation of cellular component movement Source: Ensembl
regulation of microtubule polymerization or depolymerization
Source: CAFA
Inferred from mutant phenotypeⁱ
- 12860982
response to virus
Source: UniProtKB
Inferred from expression patternⁱ
- 16548883
signal transduction
Source: ProtInc
Non-traceable author statementⁱ
- 8003023

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Developmental protein
Biological process	Differentiation, Neurogenesis

Enzyme and pathway databases

SignaLinkⁱ	P16949
SIGNORⁱ	P16949

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Stathmin Alternative name(s): Leukemia-associated phosphoprotein p18 Metablastin Oncoprotein 18 Short name: Op18 Phosphoprotein p19 Short name: pp19 Prosolin Protein Pr22 pp17
Gene namesⁱ	Name:STMN1 Synonyms:C1orf215, LAP18, OP18
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 1

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000117632.20
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:6510 STMN1
MIMⁱ	151442 gene
neXtProtⁱ	NX_P16949

Keywords - Cellular componentⁱ

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	3925
Open Targets More...OpenTargetsⁱ	ENSG00000117632
PharmGKBⁱ	PA35491

Chemistry databases

ChEMBLⁱ	CHEMBL3879843

ChEMBLⁱ

CHEMBL3879843

Polymorphism and mutation databases

BioMutaⁱ	STMN1
DMDMⁱ	134973

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		RemovedCombined sources1 Publication
ChainⁱPRO_0000182389	2 – 149	StathminAdd BLAST		148

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	2	N-acetylalanineCombined sources1 Publication	1
Modified residueⁱ	4	PhosphoserineCombined sources	1
Modified residueⁱ	9	N6-acetyllysineCombined sources	1
Modified residueⁱ	16	PhosphoserineCombined sources2 Publications	1
Modified residueⁱ	25	Phosphoserine; by CDK1, MAPK1 and MAPK3Combined sources4 Publications	1
Modified residueⁱ	29	N6-methyllysineCombined sources	1
Modified residueⁱ	31	PhosphoserineCombined sources	1
Modified residueⁱ	38	Phosphoserine; by CDK1, MAPK1 and MAPK3Combined sources4 Publications	1
Modified residueⁱ	63	Phosphoserine; by PKACombined sources	1
Modified residueⁱ	100	N6-acetyllysineCombined sources	1
Modified residueⁱ	119	N6-acetyllysineCombined sources	1

Post-translational modificationⁱ

Many different phosphorylated forms are observed depending on specific combinations among the sites which can be phosphorylated. MAPK is responsible for the phosphorylation of stathmin in response to NGF. Phosphorylation at Ser-16 seems to be required for neuron polarization (By similarity). Phosphorylation at Ser-63 reduces tubulin binding 10-fold and suppresses the MT polymerization inhibition activity.By similarity4 Publications

Keywords - PTMⁱ

Acetylation, Methylation, Phosphoprotein

Proteomic databases

EPDⁱ	P16949
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P16949
PaxDbⁱ	P16949
PeptideAtlas More...PeptideAtlasⁱ	P16949
PRIDEⁱ	P16949
ProteomicsDBⁱ	53402 53403 [P16949-2]
TopDownProteomicsⁱ	P16949-1 [P16949-1] P16949-2 [P16949-2]

2D gel databases

DOSAC-COBS 2D-PAGE database More...DOSAC-COBS-2DPAGEⁱ	P16949
REPRODUCTION-2DPAGE More...REPRODUCTION-2DPAGEⁱ	IPI00479997
SWISS-2DPAGEⁱ	P16949
UCD-2DPAGEⁱ	P16949

PTM databases

iPTMnetⁱ	P16949
PhosphoSitePlusⁱ	P16949

Expressionⁱ

Tissue specificityⁱ

Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is readily detected at substantially lower levels in all other tissues examined. Lowest expression is found in adult liver. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, non-leukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia.2 Publications

Inductionⁱ

Down-regulated in response to enterovirus 71 (EV71) infection (at protein level).1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000117632 Expressed in 217 organ(s), highest expression level in frontal cortex
CleanExⁱ	HS_STMN1
ExpressionAtlasⁱ	P16949 baseline and differential
Genevisibleⁱ	P16949 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB010107

HPAⁱ

CAB010107

Interactionⁱ

Subunit structureⁱ

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
CDKN1B	P46527	3	EBI-445909,EBI-519280
SESTD1	Q86VW0	3	EBI-445909,EBI-6117072

GO - Molecular functionⁱ

tubulin binding
Source: MGI
Inferred from direct assayⁱ
- 10675326

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	110119, 68 interactors
IntActⁱ	P16949, 22 interactors
Molecular INTeraction database More...MINTⁱ	P16949
STRINGⁱ	9606.ENSP00000410452

Structureⁱ

3D structure databases

Database of protein disorder More...DisProtⁱ	DP00174
ProteinModelPortalⁱ	P16949
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	4 – 145	SLDPROSITE-ProRule annotationAdd BLAST		142

Coiled coil

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Coiled coilⁱ	41 – 140	Sequence analysisAdd BLAST		100

Sequence similaritiesⁱ

Belongs to the stathmin family.Curated

Keywords - Domainⁱ

Coiled coil

Phylogenomic databases

eggNOGⁱ	ENOG410KGH8 Eukaryota ENOG4110S9Z LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000003691
HOGENOMⁱ	HOG000013197
HOVERGENⁱ	HBG054037
InParanoidⁱ	P16949
KEGG Orthology (KO) More...KOⁱ	K04381
OMAⁱ	DAKSEFP
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0Y2U
PhylomeDBⁱ	P16949
TreeFamⁱ	TF326935

Family and domain databases

InterProⁱ	View protein in InterPro IPR030514 Stathmin_CS IPR000956 Stathmin_fam IPR036002 Stathmin_sf
PANTHERⁱ	PTHR10104 PTHR10104, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00836 Stathmin, 1 hit
PIRSFⁱ	PIRSF002285 Stathmin, 1 hit
PRINTSⁱ	PR00345 STATHMIN
SUPFAMⁱ	SSF101494 SSF101494, 1 hit
PROSITEⁱ	View protein in PROSITE PS00563 STATHMIN_1, 1 hit PS01041 STATHMIN_2, 1 hit PS51663 STATHMIN_3, 1 hit

Sequences (2+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show all Align All

Isoform 1 (identifier: P16949-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASSDIQVKE LEKRASGQAF ELILSPRSKE SVPEFPLSPP KKKDLSLEEI 
        60         70         80         90        100
QKKLEAAEER RKSHEAEVLK QLAEKREHEK EVLQKAIEEN NNFSKMAEEK 
       110        120        130        140 
LTHKMEANKE NREAQMAAKL ERLREKDKHI EEVRKNKESK DPADETEAD

Length:149

Mass (Da):17,303

Last modified:January 23, 2007 - v3

Checksum:ⁱ316426F60DABCD01

GO

Isoform 2 (identifier: P16949-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
127-149: DKHIEEVRKNKESKDPADETEAD → MYFWTHGPGAHPAQISAEQSCLHSVPALCPALGLQSALITWSDLSHHH

« Hide

        10         20         30         40         50
MASSDIQVKE LEKRASGQAF ELILSPRSKE SVPEFPLSPP KKKDLSLEEI 
        60         70         80         90        100
QKKLEAAEER RKSHEAEVLK QLAEKREHEK EVLQKAIEEN NNFSKMAEEK 
       110        120        130        140        150
LTHKMEANKE NREAQMAAKL ERLREKMYFW THGPGAHPAQ ISAEQSCLHS 
       160        170 
VPALCPALGL QSALITWSDL SHHH

Note: No experimental confirmation available.

Show »

Length:174

Mass (Da):19,824

Checksum:ⁱ7F66FFAB6C32A5AB

GO

Computationally mapped potential isoform sequencesⁱ

There is 1 potential isoform mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name		Protein names	Gene names	Length	Annotation

	A2A2D0	A2A2D0_HUMAN		Stathmin Stathmin	STMN1	85	Annotation score:

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_041377	127 – 149	DKHIE…ETEAD → MYFWTHGPGAHPAQISAEQS CLHSVPALCPALGLQSALIT WSDLSHHH in isoform 2. 1 PublicationAdd BLAST		23

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	J04991 mRNA Translation: AAA59980.1 M31303 Genomic DNA Translation: AAA59971.1 X53305 mRNA Translation: CAA37391.1 Z11566 mRNA Translation: CAA77660.1 X94912 Genomic DNA Translation: CAA64398.1 AK303692 mRNA Translation: BAH14020.1 AK311801 mRNA Translation: BAG34744.1 AL033528 Genomic DNA No translation available. CH471059 Genomic DNA Translation: EAX07854.1 CH471059 Genomic DNA Translation: EAX07855.1 CH471059 Genomic DNA Translation: EAX07856.1 CH471059 Genomic DNA Translation: EAX07857.1 CH471059 Genomic DNA Translation: EAX07858.1 CH471059 Genomic DNA Translation: EAX07859.1 CH471059 Genomic DNA Translation: EAX07860.1 BC082228 mRNA Translation: AAH82228.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS269.1 [P16949-1] CCDS44090.1 [P16949-2]
PIRⁱ	A40936
NCBI Reference Sequences More...RefSeqⁱ	NP_001138926.1, NM_001145454.2 [P16949-2] NP_005554.1, NM_005563.3 [P16949-1] NP_981944.1, NM_203399.1 [P16949-1] NP_981946.1, NM_203401.1 [P16949-1]
UniGeneⁱ	Hs.209983

Genome annotation databases

Ensemblⁱ	ENST00000357865; ENSP00000350531; ENSG00000117632 [P16949-1] ENST00000374291; ENSP00000363409; ENSG00000117632 [P16949-1] ENST00000399728; ENSP00000382633; ENSG00000117632 [P16949-1] ENST00000426559; ENSP00000410452; ENSG00000117632 [P16949-2] ENST00000455785; ENSP00000387858; ENSG00000117632 [P16949-1]
GeneIDⁱ	3925
KEGGⁱ	hsa:3925
UCSC genome browser More...UCSCⁱ	uc001bkz.4 human [P16949-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P16949	Stathmin		BOVIN		149	UniRef100_P16949
Stathmin		GEKJA		149
Stathmin		MACFA		149
Stathmin		PIG		149
Stathmin		CALJA		149
+33
P16949-2	Stathmin		HUMAN		174	UniRef100_A0A140VJW2

Protein	Similar proteins		Species	Score	Length	Source
P16949	Stathmin		BOVIN		149	UniRef90_P16949
Stathmin		GEKJA		149
Stathmin		MACFA		149
Stathmin		PIG		149
Stathmin		CALJA		149
+43
P16949-2	Stathmin		PANTR		174	UniRef90_H2PYD0
Stathmin		PANPA		174
Stathmin		HUMAN		174
Stathmin		PONAB		174
Stathmin		GORGO		174
+15

Protein	Similar proteins		Species	Score	Length	Source
P16949	Stathmin		BOVIN		149	UniRef50_P16949
Stathmin		GEKJA		149
Stathmin		MACFA		149
Stathmin		PIG		149
Stathmin-4		XENLA		185
+259
P16949-2	Stathmin		PANTR		174	UniRef50_H2PYD0
Stathmin		PANPA		174
Stathmin		GORGO		174
Stathmin		HUMAN		174
Stathmin		PONAB		174
+125

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	J04991 mRNA Translation: AAA59980.1 M31303 Genomic DNA Translation: AAA59971.1 X53305 mRNA Translation: CAA37391.1 Z11566 mRNA Translation: CAA77660.1 X94912 Genomic DNA Translation: CAA64398.1 AK303692 mRNA Translation: BAH14020.1 AK311801 mRNA Translation: BAG34744.1 AL033528 Genomic DNA No translation available. CH471059 Genomic DNA Translation: EAX07854.1 CH471059 Genomic DNA Translation: EAX07855.1 CH471059 Genomic DNA Translation: EAX07856.1 CH471059 Genomic DNA Translation: EAX07857.1 CH471059 Genomic DNA Translation: EAX07858.1 CH471059 Genomic DNA Translation: EAX07859.1 CH471059 Genomic DNA Translation: EAX07860.1 BC082228 mRNA Translation: AAH82228.1
CCDSⁱ	CCDS269.1 [P16949-1] CCDS44090.1 [P16949-2]
PIRⁱ	A40936
RefSeqⁱ	NP_001138926.1, NM_001145454.2 [P16949-2] NP_005554.1, NM_005563.3 [P16949-1] NP_981944.1, NM_203399.1 [P16949-1] NP_981946.1, NM_203401.1 [P16949-1]
UniGeneⁱ	Hs.209983

3D structure databases

DisProtⁱ	DP00174
ProteinModelPortalⁱ	P16949
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	110119, 68 interactors
IntActⁱ	P16949, 22 interactors
MINTⁱ	P16949
STRINGⁱ	9606.ENSP00000410452

Chemistry databases

ChEMBLⁱ	CHEMBL3879843

ChEMBLⁱ

CHEMBL3879843

PTM databases

iPTMnetⁱ	P16949
PhosphoSitePlusⁱ	P16949

Polymorphism and mutation databases

BioMutaⁱ	STMN1
DMDMⁱ	134973

2D gel databases

DOSAC-COBS-2DPAGEⁱ	P16949
REPRODUCTION-2DPAGEⁱ	IPI00479997
SWISS-2DPAGEⁱ	P16949
UCD-2DPAGEⁱ	P16949

Proteomic databases

EPDⁱ	P16949
MaxQBⁱ	P16949
PaxDbⁱ	P16949
PeptideAtlasⁱ	P16949
PRIDEⁱ	P16949
ProteomicsDBⁱ	53402 53403 [P16949-2]
TopDownProteomicsⁱ	P16949-1 [P16949-1] P16949-2 [P16949-2]

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	3925
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000357865; ENSP00000350531; ENSG00000117632 [P16949-1] ENST00000374291; ENSP00000363409; ENSG00000117632 [P16949-1] ENST00000399728; ENSP00000382633; ENSG00000117632 [P16949-1] ENST00000426559; ENSP00000410452; ENSG00000117632 [P16949-2] ENST00000455785; ENSP00000387858; ENSG00000117632 [P16949-1]
GeneIDⁱ	3925
KEGGⁱ	hsa:3925
UCSCⁱ	uc001bkz.4 human [P16949-1]

Organism-specific databases

CTDⁱ	3925
DisGeNETⁱ	3925
EuPathDBⁱ	HostDB:ENSG00000117632.20
GeneCardsⁱ	STMN1
HGNCⁱ	HGNC:6510 STMN1
HPAⁱ	CAB010107
MIMⁱ	151442 gene
neXtProtⁱ	NX_P16949
OpenTargetsⁱ	ENSG00000117632
PharmGKBⁱ	PA35491
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410KGH8 Eukaryota ENOG4110S9Z LUCA
GeneTreeⁱ	ENSGT00390000003691
HOGENOMⁱ	HOG000013197
HOVERGENⁱ	HBG054037
InParanoidⁱ	P16949
KOⁱ	K04381
OMAⁱ	DAKSEFP
OrthoDBⁱ	EOG091G0Y2U
PhylomeDBⁱ	P16949
TreeFamⁱ	TF326935

Enzyme and pathway databases

SignaLinkⁱ	P16949
SIGNORⁱ	P16949

Miscellaneous databases

ChiTaRSⁱ	STMN1 human
GeneWikiⁱ	Stathmin
GenomeRNAiⁱ	3925
Protein Ontology More...PROⁱ	PR:P16949
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000117632 Expressed in 217 organ(s), highest expression level in frontal cortex
CleanExⁱ	HS_STMN1
ExpressionAtlasⁱ	P16949 baseline and differential
Genevisibleⁱ	P16949 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR030514 Stathmin_CS IPR000956 Stathmin_fam IPR036002 Stathmin_sf
PANTHERⁱ	PTHR10104 PTHR10104, 1 hit
Pfamⁱ	View protein in Pfam PF00836 Stathmin, 1 hit
PIRSFⁱ	PIRSF002285 Stathmin, 1 hit
PRINTSⁱ	PR00345 STATHMIN
SUPFAMⁱ	SSF101494 SSF101494, 1 hit
PROSITEⁱ	View protein in PROSITE PS00563 STATHMIN_1, 1 hit PS01041 STATHMIN_2, 1 hit PS51663 STATHMIN_3, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	STMN1_HUMAN
Accessionⁱ	P16949Primary (citable) accession number: P16949 Secondary accession number(s): A2A2D1 , B2R4E7, B7Z8N4, D3DPJ5
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	August 1, 1990
	Last sequence update:	January 23, 2007
	Last modified:	September 12, 2018
	This is version 196 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Direct protein sequencing, Reference proteome

Documents

Human chromosome 1
Human chromosome 1: entries, gene names and cross-references to MIM
SIMILARITY comments
Index of protein domains and families
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P16949 (STMN1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Stathmin

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Cytoskeleton

Cytoskeleton

Cytosol

Extracellular region or secreted

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

2D gel databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Coiled coil

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Polymorphism and mutation databases

2D gel databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ