Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Stathmin

Gene

STMN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear (By similarity).By similarity

GO - Molecular functioni

  • tubulin binding Source: MGI

GO - Biological processi

  • axonogenesis Source: Ensembl
  • brain development Source: Ensembl
  • establishment of skin barrier Source: CAFA
  • hepatocyte growth factor receptor signaling pathway Source: CAFA
  • intracellular signal transduction Source: ProtInc
  • microtubule depolymerization Source: MGI
  • mitotic cytokinesis Source: GO_Central
  • mitotic spindle organization Source: MGI
  • negative regulation of guanyl-nucleotide exchange factor activity Source: CAFA
  • negative regulation of microtubule polymerization Source: CAFA
  • negative regulation of Rho protein signal transduction Source: CAFA
  • negative regulation of stress fiber assembly Source: CAFA
  • negative regulation of thrombin-activated receptor signaling pathway Source: CAFA
  • neuron projection development Source: GO_Central
  • positive regulation of cellular component movement Source: Ensembl
  • regulation of microtubule polymerization or depolymerization Source: CAFA
  • response to virus Source: UniProtKB
  • signal transduction Source: ProtInc

Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Neurogenesis

Enzyme and pathway databases

SignaLinkiP16949
SIGNORiP16949

Names & Taxonomyi

Protein namesi
Recommended name:
Stathmin
Alternative name(s):
Leukemia-associated phosphoprotein p18
Metablastin
Oncoprotein 18
Short name:
Op18
Phosphoprotein p19
Short name:
pp19
Prosolin
Protein Pr22
pp17
Gene namesi
Name:STMN1
Synonyms:C1orf215, LAP18, OP18
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000117632.20
HGNCiHGNC:6510 STMN1
MIMi151442 gene
neXtProtiNX_P16949

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Organism-specific databases

DisGeNETi3925
OpenTargetsiENSG00000117632
PharmGKBiPA35491

Polymorphism and mutation databases

BioMutaiSTMN1
DMDMi134973

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00001823892 – 149StathminAdd BLAST148

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei4PhosphoserineCombined sources1
Modified residuei9N6-acetyllysineCombined sources1
Modified residuei16PhosphoserineCombined sources2 Publications1
Modified residuei25Phosphoserine; by CDK1, MAPK1 and MAPK3Combined sources4 Publications1
Modified residuei29N6-methyllysineCombined sources1
Modified residuei31PhosphoserineCombined sources1
Modified residuei38Phosphoserine; by CDK1, MAPK1 and MAPK3Combined sources4 Publications1
Modified residuei63Phosphoserine; by PKACombined sources1
Modified residuei100N6-acetyllysineCombined sources1
Modified residuei119N6-acetyllysineCombined sources1

Post-translational modificationi

Many different phosphorylated forms are observed depending on specific combinations among the sites which can be phosphorylated. MAPK is responsible for the phosphorylation of stathmin in response to NGF. Phosphorylation at Ser-16 seems to be required for neuron polarization (By similarity). Phosphorylation at Ser-63 reduces tubulin binding 10-fold and suppresses the MT polymerization inhibition activity.By similarity4 Publications

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

EPDiP16949
MaxQBiP16949
PaxDbiP16949
PeptideAtlasiP16949
PRIDEiP16949
ProteomicsDBi53402
53403 [P16949-2]
TopDownProteomicsiP16949-1 [P16949-1]
P16949-2 [P16949-2]

2D gel databases

DOSAC-COBS-2DPAGEiP16949
REPRODUCTION-2DPAGEiIPI00479997
SWISS-2DPAGEiP16949
UCD-2DPAGEiP16949

PTM databases

iPTMnetiP16949
PhosphoSitePlusiP16949

Expressioni

Tissue specificityi

Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is readily detected at substantially lower levels in all other tissues examined. Lowest expression is found in adult liver. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, non-leukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia.2 Publications

Inductioni

Down-regulated in response to enterovirus 71 (EV71) infection (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000117632
CleanExiHS_STMN1
ExpressionAtlasiP16949 baseline and differential
GenevisibleiP16949 HS

Organism-specific databases

HPAiCAB010107

Interactioni

Subunit structurei

Binds to two alpha/beta-tubulin heterodimers. Interacts with KIST.2 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • tubulin binding Source: MGI

Protein-protein interaction databases

BioGridi110119, 68 interactors
IntActiP16949, 21 interactors
MINTiP16949
STRINGi9606.ENSP00000410452

Structurei

3D structure databases

DisProtiDP00174
ProteinModelPortaliP16949
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 145SLDPROSITE-ProRule annotationAdd BLAST142

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili41 – 140Sequence analysisAdd BLAST100

Sequence similaritiesi

Belongs to the stathmin family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410KGH8 Eukaryota
ENOG4110S9Z LUCA
GeneTreeiENSGT00390000003691
HOGENOMiHOG000013197
HOVERGENiHBG054037
InParanoidiP16949
KOiK04381
OMAiDAKSEFP
OrthoDBiEOG091G0Y2U
PhylomeDBiP16949
TreeFamiTF326935

Family and domain databases

InterProiView protein in InterPro
IPR030514 Stathmin_CS
IPR000956 Stathmin_fam
IPR036002 Stathmin_sf
PANTHERiPTHR10104 PTHR10104, 1 hit
PfamiView protein in Pfam
PF00836 Stathmin, 1 hit
PIRSFiPIRSF002285 Stathmin, 1 hit
PRINTSiPR00345 STATHMIN
SUPFAMiSSF101494 SSF101494, 1 hit
PROSITEiView protein in PROSITE
PS00563 STATHMIN_1, 1 hit
PS01041 STATHMIN_2, 1 hit
PS51663 STATHMIN_3, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P16949-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASSDIQVKE LEKRASGQAF ELILSPRSKE SVPEFPLSPP KKKDLSLEEI
60 70 80 90 100
QKKLEAAEER RKSHEAEVLK QLAEKREHEK EVLQKAIEEN NNFSKMAEEK
110 120 130 140
LTHKMEANKE NREAQMAAKL ERLREKDKHI EEVRKNKESK DPADETEAD
Length:149
Mass (Da):17,303
Last modified:January 23, 2007 - v3
Checksum:i316426F60DABCD01
GO
Isoform 2 (identifier: P16949-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-149: DKHIEEVRKNKESKDPADETEAD → MYFWTHGPGAHPAQISAEQSCLHSVPALCPALGLQSALITWSDLSHHH

Note: No experimental confirmation available.
Show »
Length:174
Mass (Da):19,824
Checksum:i7F66FFAB6C32A5AB
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_041377127 – 149DKHIE…ETEAD → MYFWTHGPGAHPAQISAEQS CLHSVPALCPALGLQSALIT WSDLSHHH in isoform 2. 1 PublicationAdd BLAST23

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J04991 mRNA Translation: AAA59980.1
M31303 Genomic DNA Translation: AAA59971.1
X53305 mRNA Translation: CAA37391.1
Z11566 mRNA Translation: CAA77660.1
X94912 Genomic DNA Translation: CAA64398.1
AK303692 mRNA Translation: BAH14020.1
AK311801 mRNA Translation: BAG34744.1
AL033528 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07854.1
CH471059 Genomic DNA Translation: EAX07855.1
CH471059 Genomic DNA Translation: EAX07856.1
CH471059 Genomic DNA Translation: EAX07857.1
CH471059 Genomic DNA Translation: EAX07858.1
CH471059 Genomic DNA Translation: EAX07859.1
CH471059 Genomic DNA Translation: EAX07860.1
BC082228 mRNA Translation: AAH82228.1
CCDSiCCDS269.1 [P16949-1]
CCDS44090.1 [P16949-2]
PIRiA40936
RefSeqiNP_001138926.1, NM_001145454.2 [P16949-2]
NP_005554.1, NM_005563.3 [P16949-1]
NP_981944.1, NM_203399.1 [P16949-1]
NP_981946.1, NM_203401.1 [P16949-1]
UniGeneiHs.209983

Genome annotation databases

EnsembliENST00000357865; ENSP00000350531; ENSG00000117632 [P16949-1]
ENST00000374291; ENSP00000363409; ENSG00000117632 [P16949-1]
ENST00000399728; ENSP00000382633; ENSG00000117632 [P16949-1]
ENST00000426559; ENSP00000410452; ENSG00000117632 [P16949-2]
ENST00000455785; ENSP00000387858; ENSG00000117632 [P16949-1]
GeneIDi3925
KEGGihsa:3925
UCSCiuc001bkz.4 human [P16949-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSTMN1_HUMAN
AccessioniPrimary (citable) accession number: P16949
Secondary accession number(s): A2A2D1
, B2R4E7, B7Z8N4, D3DPJ5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: January 23, 2007
Last modified: June 20, 2018
This is version 194 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health