Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P16949 (STMN1_HUMAN)

Entry version 217 (02 Jun 2021)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Stathmin

Gene

STMN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear (By similarity).

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Neurogenesis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P16949

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1251985, Nuclear signaling by ERBB4

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P16949

SIGNOR Signaling Network Open Resource

More...SIGNORi		P16949

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Stathmin
Alternative name(s):
Leukemia-associated phosphoprotein p18
Metablastin
Oncoprotein 18
Short name:
Op18
Phosphoprotein p19
Short name:
pp19
Prosolin
Protein Pr22
pp17
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:STMN1
Synonyms:C1orf215, LAP18, OP18
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:6510, STMN1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		151442, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P16949

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000117632.20

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		3925

Open Targets

More...OpenTargetsi		ENSG00000117632

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA35491

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P16949, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3879843

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		STMN1

Domain mapping of disease mutations (DMDM)

More...DMDMi		134973

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources1 Publication
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001823892 – 149StathminAdd BLAST148

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei4PhosphoserineCombined sources1
Modified residuei9N6-acetyllysineCombined sources1
Modified residuei16PhosphoserineCombined sources2 Publications1
Modified residuei25Phosphoserine; by CDK1, MAPK1 and MAPK3Combined sources4 Publications1
Modified residuei29N6-methyllysineCombined sources1
Modified residuei31PhosphoserineCombined sources1
Modified residuei38Phosphoserine; by CDK1, MAPK1 and MAPK3Combined sources4 Publications1
Modified residuei63Phosphoserine; by PKACombined sources1
Modified residuei100N6-acetyllysineCombined sources1
Modified residuei119N6-acetyllysineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Many different phosphorylated forms are observed depending on specific combinations among the sites which can be phosphorylated. MAPK is responsible for the phosphorylation of stathmin in response to NGF. Phosphorylation at Ser-16 seems to be required for neuron polarization (By similarity). Phosphorylation at Ser-63 reduces tubulin binding 10-fold and suppresses the MT polymerization inhibition activity.By similarity4 Publications

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...CPTACi		CPTAC-1009
CPTAC-1010
CPTAC-1368

Encyclopedia of Proteome Dynamics

More...EPDi		P16949

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P16949

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P16949

MaxQB - The MaxQuant DataBase

More...MaxQBi		P16949

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P16949

PeptideAtlas

More...PeptideAtlasi		P16949

PRoteomics IDEntifications database

More...PRIDEi		P16949

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		53402 [P16949-1]
53403 [P16949-2]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		P16949-1 [P16949-1]
P16949-2 [P16949-2]

2D gel databases

DOSAC-COBS 2D-PAGE database

More...DOSAC-COBS-2DPAGEi		P16949

REPRODUCTION-2DPAGE

More...REPRODUCTION-2DPAGEi		IPI00479997

Two-dimensional polyacrylamide gel electrophoresis database from the Geneva University Hospital

More...SWISS-2DPAGEi		P16949

University College Dublin 2-DE Proteome Database

More...UCD-2DPAGEi		P16949

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P16949

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P16949

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P16949

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is readily detected at substantially lower levels in all other tissues examined. Lowest expression is found in adult liver. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, non-leukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Down-regulated in response to enterovirus 71 (EV71) infection (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000117632, Expressed in cortical plate and 230 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P16949, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P16949, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000117632, Tissue enhanced (brain, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds to two alpha/beta-tubulin heterodimers.

Interacts with KIST.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		110119, 88 interactors

Protein interaction database and analysis system

More...IntActi		P16949, 28 interactors

Molecular INTeraction database

More...MINTi		P16949

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000410452

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P16949, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P16949

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini4 – 145SLDPROSITE-ProRule annotationAdd BLAST142

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni121 – 149DisorderedSequence analysisAdd BLAST29

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili41 – 140Sequence analysisAdd BLAST100

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the stathmin family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1280, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT01030000234597

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_1562320_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P16949

Identification of Orthologs from Complete Genome Data

More...OMAi		RESHIND

Database of Orthologous Groups

More...OrthoDBi		1381987at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P16949

TreeFam database of animal gene trees

More...TreeFami		TF326935

Family and domain databases

Database of protein disorder

More...DisProti		DP00174

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR030514, Stathmin_CS
IPR000956, Stathmin_fam
IPR036002, Stathmin_sf

The PANTHER Classification System

More...PANTHERi		PTHR10104, PTHR10104, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00836, Stathmin, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF002285, Stathmin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00345, STATHMIN

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF101494, SSF101494, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00563, STATHMIN_1, 1 hit
PS01041, STATHMIN_2, 1 hit
PS51663, STATHMIN_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P16949-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASSDIQVKE LEKRASGQAF ELILSPRSKE SVPEFPLSPP KKKDLSLEEI 
        60         70         80         90        100
QKKLEAAEER RKSHEAEVLK QLAEKREHEK EVLQKAIEEN NNFSKMAEEK 
       110        120        130        140 
LTHKMEANKE NREAQMAAKL ERLREKDKHI EEVRKNKESK DPADETEAD
Length:149
Mass (Da):17,303
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i316426F60DABCD01
GO
Isoform 2 (identifier: P16949-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-149: DKHIEEVRKNKESKDPADETEAD → MYFWTHGPGAHPAQISAEQSCLHSVPALCPALGLQSALITWSDLSHHH

Show »
Length:174
Mass (Da):19,824
Checksum:i7F66FFAB6C32A5AB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2A2D0A2A2D0_HUMAN
Stathmin
STMN1
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_041377127 – 149DKHIE…ETEAD → MYFWTHGPGAHPAQISAEQS CLHSVPALCPALGLQSALIT WSDLSHHH in isoform 2. 1 PublicationAdd BLAST23

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
J04991 mRNA Translation: AAA59980.1
M31303 Genomic DNA Translation: AAA59971.1
X53305 mRNA Translation: CAA37391.1
Z11566 mRNA Translation: CAA77660.1
X94912 Genomic DNA Translation: CAA64398.1
AK303692 mRNA Translation: BAH14020.1
AK311801 mRNA Translation: BAG34744.1
AL033528 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07854.1
CH471059 Genomic DNA Translation: EAX07855.1
CH471059 Genomic DNA Translation: EAX07856.1
CH471059 Genomic DNA Translation: EAX07857.1
CH471059 Genomic DNA Translation: EAX07858.1
CH471059 Genomic DNA Translation: EAX07859.1
CH471059 Genomic DNA Translation: EAX07860.1
BC082228 mRNA Translation: AAH82228.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS269.1 [P16949-1]
CCDS44090.1 [P16949-2]

Protein sequence database of the Protein Information Resource

More...PIRi		A40936

NCBI Reference Sequences

More...RefSeqi		NP_001138926.1, NM_001145454.2 [P16949-2]
NP_005554.1, NM_005563.3 [P16949-1]
NP_981944.1, NM_203399.1 [P16949-1]
NP_981946.1, NM_203401.1 [P16949-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000357865; ENSP00000350531; ENSG00000117632 [P16949-1]
ENST00000374291; ENSP00000363409; ENSG00000117632 [P16949-1]
ENST00000399728; ENSP00000382633; ENSG00000117632 [P16949-1]
ENST00000426559; ENSP00000410452; ENSG00000117632 [P16949-2]
ENST00000455785; ENSP00000387858; ENSG00000117632 [P16949-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		3925

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:3925

UCSC genome browser

More...UCSCi		uc001bkz.4, human [P16949-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J04991 mRNA Translation: AAA59980.1
M31303 Genomic DNA Translation: AAA59971.1
X53305 mRNA Translation: CAA37391.1
Z11566 mRNA Translation: CAA77660.1
X94912 Genomic DNA Translation: CAA64398.1
AK303692 mRNA Translation: BAH14020.1
AK311801 mRNA Translation: BAG34744.1
AL033528 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07854.1
CH471059 Genomic DNA Translation: EAX07855.1
CH471059 Genomic DNA Translation: EAX07856.1
CH471059 Genomic DNA Translation: EAX07857.1
CH471059 Genomic DNA Translation: EAX07858.1
CH471059 Genomic DNA Translation: EAX07859.1
CH471059 Genomic DNA Translation: EAX07860.1
BC082228 mRNA Translation: AAH82228.1
CCDSiCCDS269.1 [P16949-1]
CCDS44090.1 [P16949-2]
PIRiA40936
RefSeqiNP_001138926.1, NM_001145454.2 [P16949-2]
NP_005554.1, NM_005563.3 [P16949-1]
NP_981944.1, NM_203399.1 [P16949-1]
NP_981946.1, NM_203401.1 [P16949-1]

3D structure databases

SMRiP16949
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi110119, 88 interactors
IntActiP16949, 28 interactors
MINTiP16949
STRINGi9606.ENSP00000410452

Chemistry databases

ChEMBLiCHEMBL3879843

PTM databases

iPTMnetiP16949
PhosphoSitePlusiP16949
SwissPalmiP16949

Genetic variation databases

BioMutaiSTMN1
DMDMi134973

2D gel databases

DOSAC-COBS-2DPAGEiP16949
REPRODUCTION-2DPAGEiIPI00479997
SWISS-2DPAGEiP16949
UCD-2DPAGEiP16949

Proteomic databases

CPTACiCPTAC-1009
CPTAC-1010
CPTAC-1368
EPDiP16949
jPOSTiP16949
MassIVEiP16949
MaxQBiP16949
PaxDbiP16949
PeptideAtlasiP16949
PRIDEiP16949
ProteomicsDBi53402 [P16949-1]
53403 [P16949-2]
TopDownProteomicsiP16949-1 [P16949-1]
P16949-2 [P16949-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		4112, 1444 antibodies

The DNASU plasmid repository

More...DNASUi		3925

Genome annotation databases

EnsembliENST00000357865; ENSP00000350531; ENSG00000117632 [P16949-1]
ENST00000374291; ENSP00000363409; ENSG00000117632 [P16949-1]
ENST00000399728; ENSP00000382633; ENSG00000117632 [P16949-1]
ENST00000426559; ENSP00000410452; ENSG00000117632 [P16949-2]
ENST00000455785; ENSP00000387858; ENSG00000117632 [P16949-1]
GeneIDi3925
KEGGihsa:3925
UCSCiuc001bkz.4, human [P16949-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3925
DisGeNETi3925

GeneCards: human genes, protein and diseases

More...GeneCardsi		STMN1
HGNCiHGNC:6510, STMN1
HPAiENSG00000117632, Tissue enhanced (brain, lymphoid tissue)
MIMi151442, gene
neXtProtiNX_P16949
OpenTargetsiENSG00000117632
PharmGKBiPA35491
VEuPathDBiHostDB:ENSG00000117632.20

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1280, Eukaryota
GeneTreeiENSGT01030000234597
HOGENOMiCLU_1562320_0_0_1
InParanoidiP16949
OMAiRESHIND
OrthoDBi1381987at2759
PhylomeDBiP16949
TreeFamiTF326935

Enzyme and pathway databases

PathwayCommonsiP16949
ReactomeiR-HSA-1251985, Nuclear signaling by ERBB4
SignaLinkiP16949
SIGNORiP16949

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		3925, 15 hits in 1000 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		STMN1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Stathmin

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		3925
PharosiP16949, Tbio

Protein Ontology

More...PROi		PR:P16949
RNActiP16949, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000117632, Expressed in cortical plate and 230 other tissues
ExpressionAtlasiP16949, baseline and differential
GenevisibleiP16949, HS

Family and domain databases

DisProtiDP00174
InterProiView protein in InterPro
IPR030514, Stathmin_CS
IPR000956, Stathmin_fam
IPR036002, Stathmin_sf
PANTHERiPTHR10104, PTHR10104, 1 hit
PfamiView protein in Pfam
PF00836, Stathmin, 1 hit
PIRSFiPIRSF002285, Stathmin, 1 hit
PRINTSiPR00345, STATHMIN
SUPFAMiSSF101494, SSF101494, 1 hit
PROSITEiView protein in PROSITE
PS00563, STATHMIN_1, 1 hit
PS01041, STATHMIN_2, 1 hit
PS51663, STATHMIN_3, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSTMN1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P16949
Secondary accession number(s): A2A2D1
, B2R4E7, B7Z8N4, D3DPJ5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: January 23, 2007
Last modified: June 2, 2021
This is version 217 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again