UniProtKB - P16410 (CTLA4_HUMAN)
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|P16410|CTLA4_HUMAN Cytotoxic T-lymphocyte protein 4 OS=Homo sapiens OX=9606 GN=CTLA4 PE=1 SV=3 MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY ASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR AMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL LTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
- Align
Cytotoxic T-lymphocyte protein 4
CTLA4
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.11"CTLA-4 is a second receptor for the B cell activation antigen B7."
Linsley P.S., Brady W., Urnes M., Griosmaire L.S., Damle N.K., Ledbetter J.A.
J. Exp. Med. 174:561-569(1991) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.17"A molecular perspective of CTLA-4 function."
Teft W.A., Kirchhof M.G., Madrenas J.
Annu. Rev. Immunol. 24:65-97(2006) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, TISSUE SPECIFICITY.
Miscellaneous
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- adaptive immune response Source: UniProtKB-KW
- B cell receptor signaling pathway Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- cellular response to DNA damage stimulus Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- immune response Source: ProtInc <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- negative regulation of B cell proliferation Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- negative regulation of immune response Source: Ensembl
- negative regulation of regulatory T cell differentiation Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- negative regulation of T cell proliferation Source: Ensembl
- positive regulation of apoptotic process Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- regulation of regulatory T cell differentiation Source: Reactome
- T cell costimulation Source: Reactome
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Biological process | Adaptive immunity, Immunity |
Enzyme and pathway databases
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-HSA-389513 CTLA4 inhibitory signaling R-HSA-8877330 RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs) |
SIGNOR Signaling Network Open Resource More...SIGNORi | P16410 |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: Cytotoxic T-lymphocyte protein 4Alternative name(s): Cytotoxic T-lymphocyte-associated antigen 4 Short name: CTLA-4 CD_antigen: CD152 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:CTLA4 Synonyms:CD152 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Homo sapiens (Human) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9606 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000163599.14 |
Human Gene Nomenclature Database More...HGNCi | HGNC:2505 CTLA4 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 123890 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_P16410 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Plasma membrane
- Cell membrane 2 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.18"CTLA-4 trafficking and surface expression."
Valk E., Rudd C.E., Schneider H.
Trends Immunol. 29:272-279(2008) [PubMed] [Europe PMC] [Abstract]Cited for: SUBCELLULAR LOCATION. - Ref.25"Structural basis for cancer immunotherapy by the first-in-class checkpoint inhibitor ipilimumab."
Ramagopal U.A., Liu W., Garrett-Thomson S.C., Bonanno J.B., Yan Q., Srinivasan M., Wong S.C., Bell A., Mankikar S., Rangan V.S., Deshpande S., Korman A.J., Almo S.C.
Proc. Natl. Acad. Sci. U.S.A. 114:E4223-E4232(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (3.00 ANGSTROMS) OF 37-154 IN COMPLEX WITH THERAPEUTIC ANTIBODY IPILIMUMAB, SUBUNIT, INTERACTION WITH CD80; CD86 AND ICOSLG, SUBCELLULAR LOCATION, TOPOLOGY, DISULFIDE BONDS, MUTAGENESIS OF VAL-45; LEU-47; SER-49; ARG-70; LYS-130; GLU-132; TYR-139 AND ILE-143.
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.18"CTLA-4 trafficking and surface expression."
Valk E., Rudd C.E., Schneider H.
Trends Immunol. 29:272-279(2008) [PubMed] [Europe PMC] [Abstract]Cited for: SUBCELLULAR LOCATION. - Ref.25"Structural basis for cancer immunotherapy by the first-in-class checkpoint inhibitor ipilimumab."
Ramagopal U.A., Liu W., Garrett-Thomson S.C., Bonanno J.B., Yan Q., Srinivasan M., Wong S.C., Bell A., Mankikar S., Rangan V.S., Deshpande S., Korman A.J., Almo S.C.
Proc. Natl. Acad. Sci. U.S.A. 114:E4223-E4232(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (3.00 ANGSTROMS) OF 37-154 IN COMPLEX WITH THERAPEUTIC ANTIBODY IPILIMUMAB, SUBUNIT, INTERACTION WITH CD80; CD86 AND ICOSLG, SUBCELLULAR LOCATION, TOPOLOGY, DISULFIDE BONDS, MUTAGENESIS OF VAL-45; LEU-47; SER-49; ARG-70; LYS-130; GLU-132; TYR-139 AND ILE-143.
Note: Exists primarily an intracellular antigen whose surface expression is tightly regulated by restricted trafficking to the cell surface and rapid internalisation;.- Cell membrane 2 Publications
Golgi apparatus
- Golgi apparatus Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
Plasma Membrane
- external side of plasma membrane Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- integral component of plasma membrane Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- plasma membrane Source: Reactome
Other locations
- clathrin-coated endocytic vesicle Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- perinuclear region of cytoplasm Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- protein complex involved in cell adhesion Source: MGI <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
Topology
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini | 36 – 161 | Extracellular1 Publication <p>Manually curated information which has been inferred by a curator based on his/her scientific knowledge or on the scientific content of an article.</p> <p><a href="/manual/evidences#ECO:0000305">More...</a></p> Manual assertion inferred by curator fromi
| 126 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei | 162 – 182 | HelicalSequence analysisAdd BLAST | 21 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini | 183 – 223 | CytoplasmicSequence analysisAdd BLAST | 41 |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti
Cell membrane, Membrane<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei
Systemic lupus erythematosus (SLE)2 Publications
<p>Manually curated information for which there is published experimental evidence.</p>
<p><a href="/manual/evidences#ECO:0000269">More...</a></p>
Manual assertion based on experiment ini
- Ref.31"Evidence for CTLA4 as a susceptibility gene for systemic lupus erythematosus."
Barreto M., Santos E., Ferreira R., Fesel C., Fontes M.F., Pereira C., Martins B., Andreia R., Viana J.F., Crespo F., Vasconcelos C., Ferreira C., Vicente A.M.
Eur. J. Hum. Genet. 12:620-626(2004) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM, INVOLVEMENT IN SYSTEMIC LUPUS ERYTHEMATOSUS. - Ref.34"CTLA-4 polymorphisms and systemic lupus erythematosus (SLE): a meta-analysis."
Lee Y.H., Harley J.B., Nath S.K.
Hum. Genet. 116:361-367(2005) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM, INVOLVEMENT IN SYSTEMIC LUPUS ERYTHEMATOSUS.
Barreto M., Santos E., Ferreira R., Fesel C., Fontes M.F., Pereira C., Martins B., Andreia R., Viana J.F., Crespo F., Vasconcelos C., Ferreira C., Vicente A.M.
Eur. J. Hum. Genet. 12:620-626(2004) [PubMed] [Europe PMC] [Abstract]
Lee Y.H., Harley J.B., Nath S.K.
Hum. Genet. 116:361-367(2005) [PubMed] [Europe PMC] [Abstract]
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.29"Complex association analysis of Graves disease using a set of polymorphic markers."
Chistyakov D.A., Savost'anov K.V., Turakulov R.I., Petunina N.A., Trukhina L.V., Kudinova A.V., Balabolkin M.I., Nosikov V.V.
Mol. Genet. Metab. 70:214-218(2000) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM, VARIANT ALA-17, INVOLVEMENT IN GRAVES DISEASE.
Diabetes mellitus, insulin-dependent, 12 (IDDM12)1 Publication
<p>Manually curated information for which there is published experimental evidence.</p>
<p><a href="/manual/evidences#ECO:0000269">More...</a></p>
Manual assertion based on experiment ini
- Ref.26"Insulin-dependent diabetes mellitus (IDDM) is associated with CTLA4 polymorphisms in multiple ethnic groups."
Marron M.P., Raffel L.J., Garchon H.-J., Jacob C.O., Serrano-Rios M., Martinez Larrad M.T., Teng W.-P., Park Y., Zhang Z.-X., Goldstein D.R., Tao Y.-W., Beaurain G., Bach J.-F., Huang H.-S., Luo D.-F., Zeidler A., Rotter J.I., Yang M.C.K. , Modilevsky T., Maclaren N.K., She J.-X.
Hum. Mol. Genet. 6:1275-1282(1997) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANT ALA-17, INVOLVEMENT IN IDDM12.
Marron M.P., Raffel L.J., Garchon H.-J., Jacob C.O., Serrano-Rios M., Martinez Larrad M.T., Teng W.-P., Park Y., Zhang Z.-X., Goldstein D.R., Tao Y.-W., Beaurain G., Bach J.-F., Huang H.-S., Luo D.-F., Zeidler A., Rotter J.I., Yang M.C.K. , Modilevsky T., Maclaren N.K., She J.-X.
Hum. Mol. Genet. 6:1275-1282(1997) [PubMed] [Europe PMC] [Abstract]
Celiac disease 3 (CELIAC3)2 Publications
<p>Manually curated information for which there is published experimental evidence.</p>
<p><a href="/manual/evidences#ECO:0000269">More...</a></p>
Manual assertion based on experiment ini
- Ref.27"CTLA-4 gene polymorphism is associated with predisposition to coeliac disease."
Djilali-Saiah I., Schmitz J., Harfouch-Hammoud E., Mougenot J.-F., Bach J.-F., Caillat-Zucman S.
Gut 43:187-189(1998) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM, INVOLVEMENT IN CELIAC3. - Ref.33"A common CTLA4 haplotype associated with coeliac disease."
Hunt K.A., McGovern D.P.B., Kumar P.J., Ghosh S., Travis S.P.L., Walters J.R.F., Jewell D.P., Playford R.J., van Heel D.A.
Eur. J. Hum. Genet. 13:440-444(2005) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM, INVOLVEMENT IN CELIAC3.
Djilali-Saiah I., Schmitz J., Harfouch-Hammoud E., Mougenot J.-F., Bach J.-F., Caillat-Zucman S.
Gut 43:187-189(1998) [PubMed] [Europe PMC] [Abstract]
Hunt K.A., McGovern D.P.B., Kumar P.J., Ghosh S., Travis S.P.L., Walters J.R.F., Jewell D.P., Playford R.J., van Heel D.A.
Eur. J. Hum. Genet. 13:440-444(2005) [PubMed] [Europe PMC] [Abstract]
Autoimmune lymphoproliferative syndrome 5 (ALPS5)2 Publications
<p>Manually curated information for which there is published experimental evidence.</p>
<p><a href="/manual/evidences#ECO:0000269">More...</a></p>
Manual assertion based on experiment ini
- Ref.35"Autosomal dominant immune dysregulation syndrome in humans with CTLA4 mutations."
Schubert D., Bode C., Kenefeck R., Hou T.Z., Wing J.B., Kennedy A., Bulashevska A., Petersen B.S., Schaeffer A.A., Gruening B.A., Unger S., Frede N., Baumann U., Witte T., Schmidt R.E., Dueckers G., Niehues T., Seneviratne S. , Kanariou M., Speckmann C., Ehl S., Rensing-Ehl A., Warnatz K., Rakhmanov M., Thimme R., Hasselblatt P., Emmerich F., Cathomen T., Backofen R., Fisch P., Seidl M., May A., Schmitt-Graeff A., Ikemizu S., Salzer U., Franke A., Sakaguchi S., Walker L.S., Sansom D.M., Grimbacher B.
Nat. Med. 20:1410-1416(2014) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM, INVOLVEMENT IN ALPS5, VARIANT ALPS5 TRP-70. - Ref.36"Immune dysregulation in human subjects with heterozygous germline mutations in CTLA4."
Kuehn H.S., Ouyang W., Lo B., Deenick E.K., Niemela J.E., Avery D.T., Schickel J.N., Tran D.Q., Stoddard J., Zhang Y., Frucht D.M., Dumitriu B., Scheinberg P., Folio L.R., Frein C.A., Price S., Koh C., Heller T. , Seroogy C.M., Huttenlocher A., Rao V.K., Su H.C., Kleiner D., Notarangelo L.D., Rampertaap Y., Olivier K.N., McElwee J., Hughes J., Pittaluga S., Oliveira J.B., Meffre E., Fleisher T.A., Holland S.M., Lenardo M.J., Tangye S.G., Uzel G.
Science 345:1623-1627(2014) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM, INVOLVEMENT IN ALPS5.
Schubert D., Bode C., Kenefeck R., Hou T.Z., Wing J.B., Kennedy A., Bulashevska A., Petersen B.S., Schaeffer A.A., Gruening B.A., Unger S., Frede N., Baumann U., Witte T., Schmidt R.E., Dueckers G., Niehues T., Seneviratne S. , Kanariou M., Speckmann C., Ehl S., Rensing-Ehl A., Warnatz K., Rakhmanov M., Thimme R., Hasselblatt P., Emmerich F., Cathomen T., Backofen R., Fisch P., Seidl M., May A., Schmitt-Graeff A., Ikemizu S., Salzer U., Franke A., Sakaguchi S., Walker L.S., Sansom D.M., Grimbacher B.
Nat. Med. 20:1410-1416(2014) [PubMed] [Europe PMC] [Abstract]
Kuehn H.S., Ouyang W., Lo B., Deenick E.K., Niemela J.E., Avery D.T., Schickel J.N., Tran D.Q., Stoddard J., Zhang Y., Frucht D.M., Dumitriu B., Scheinberg P., Folio L.R., Frein C.A., Price S., Koh C., Heller T. , Seroogy C.M., Huttenlocher A., Rao V.K., Su H.C., Kleiner D., Notarangelo L.D., Rampertaap Y., Olivier K.N., McElwee J., Hughes J., Pittaluga S., Oliveira J.B., Meffre E., Fleisher T.A., Holland S.M., Lenardo M.J., Tangye S.G., Uzel G.
Science 345:1623-1627(2014) [PubMed] [Europe PMC] [Abstract]
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_072681 | 70 | R → W in ALPS5. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
<p>This subsection of the ‘Pathology and Biotech’ section describes the use of a protein as a pharmaceutical drug. It indicates the name of the drug, the name of the firm that commercializes it and explains in a few words in which context the drug is used. In some cases, drugs that are under development are also described.<p><a href='/help/pharmaceutical_use' target='_top'>More...</a></p>Pharmaceutical usei
Mutagenesis
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 45 | V → D: Strongly reduced interaction with CD80, CD86 and ICOSLG. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 47 | L → D: Strongly reduced interaction with CD80, CD86 and ICOSLG. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 49 | S → A: Strongly reduced interaction with CD80, CD86 and ICOSLG. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 70 | R → A or D: Strongly reduced interaction with CD80, CD86 and ICOSLG. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 130 | K → A or D: Strongly reduced interaction with CD80, CD86 and ICOSLG. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 132 | E → A or R: Strongly reduced interaction with CD80, CD86 and ICOSLG. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 139 | Y → A or D: Strongly reduced interaction with CD80, CD86 and ICOSLG. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 143 | I → A or D: Strongly reduced interaction with CD80, CD86 and ICOSLG. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Diseasei
Diabetes mellitus, Disease mutation, Systemic lupus erythematosusOrganism-specific databases
DisGeNET More...DisGeNETi | 1493 |
MalaCards human disease database More...MalaCardsi | CTLA4 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 109100 phenotype 152700 phenotype 601388 phenotype 609755 phenotype 610424 phenotype 616100 phenotype |
Open Targets More...OpenTargetsi | ENSG00000163599 |
Orphanet; a database dedicated to information on rare diseases and orphan drugs More...Orphaneti | 555 Celiac disease 900 Granulomatosis with polyangiitis 855 Hashimoto struma 536 Systemic lupus erythematosus |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA27006 |
Chemistry databases
ChEMBL database of bioactive drug-like small molecules More...ChEMBLi | CHEMBL2364164 |
Drug and drug target database More...DrugBanki | DB06186 Ipilimumab |
IUPHAR/BPS Guide to PHARMACOLOGY More...GuidetoPHARMACOLOGYi | 2743 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | CTLA4 |
Domain mapping of disease mutations (DMDM) More...DMDMi | 27735177 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei | 1 – 35 | Sequence analysisAdd BLAST | 35 | |
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000014734 | 36 – 223 | Cytotoxic T-lymphocyte protein 4Add BLAST | 188 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 58 ↔ 129 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei 6 Publications<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| ||
| <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 85 ↔ 103 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei 6 Publications<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| ||
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi | 113 | N-linked (GlcNAc...) asparagine3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi | 145 | N-linked (GlcNAc...) asparagine2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 157 | InterchainCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei 2 Publications<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| ||
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 201 | Phosphotyrosine; by TXK and JAK23 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.16"Hierarchical regulation of CTLA-4 dimer-based lattice formation and its biological relevance for T cell inactivation."
Darlington P.J., Kirchhof M.G., Criado G., Sondhi J., Madrenas J.
J. Immunol. 175:996-1004(2005) [PubMed] [Europe PMC] [Abstract]Cited for: GLYCOSYLATION AT ASN-113 AND ASN-145. - Ref.22"Crystal structure of the B7-1/CTLA-4 complex that inhibits human immune responses."
Stamper C.C., Zhang Y., Tobin J.F., Erbe D.V., Ikemizu S., Davis S.J., Stahl M.L., Seehra J., Somers W.S., Mosyak L.
Nature 410:608-611(2001) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 36-161 IN COMPLEX WITH CD80, SUBUNIT, DISULFIDE BONDS, GLYCOSYLATION AT ASN-113 AND ASN-145. - Ref.24"Rigid-body ligand recognition drives cytotoxic T-lymphocyte antigen 4 (CTLA-4) receptor triggering."
Yu C., Sonnen A.F., George R., Dessailly B.H., Stagg L.J., Evans E.J., Orengo C.A., Stuart D.I., Ladbury J.E., Ikemizu S., Gilbert R.J., Davis S.J.
J. Biol. Chem. 286:6685-6696(2011) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 36-161, GLYCOSYLATION AT ASN-113, SUBUNIT, DISULFIDE BONDS.
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.12"Tyrosine phosphorylation controls internalization of CTLA-4 by regulating its interaction with clathrin-associated adaptor complex AP-2."
Shiratori T., Miyatake S., Ohno H., Nakaseko C., Isono K., Bonifacino J.S., Saito T.
Immunity 6:583-589(1997) [PubMed] [Europe PMC] [Abstract]Cited for: PHOSPHORYLATION AT TYR-201. - Ref.13"Resting lymphocyte kinase (Rlk/Txk) phosphorylates the YVKM motif and regulates PI 3-kinase binding to T-cell antigen CTLA-4."
Schneider H., Schwartzberg P.L., Rudd C.E.
Biochem. Biophys. Res. Commun. 252:14-19(1998) [PubMed] [Europe PMC] [Abstract]Cited for: PHOSPHORYLATION AT TYR-201. - Ref.14"Janus kinase 2 is associated with a box 1-like motif and phosphorylates a critical tyrosine residue in the cytoplasmic region of cytotoxic T lymphocyte associated molecule-4."
Chikuma S., Murakami M., Tanaka K., Uede T.
J. Cell. Biochem. 78:241-250(2000) [PubMed] [Europe PMC] [Abstract]Cited for: PHOSPHORYLATION AT TYR-201 BY JAK2.
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi
Disulfide bond, Glycoprotein, PhosphoproteinProteomic databases
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P16410 |
PeptideAtlas More...PeptideAtlasi | P16410 |
PRoteomics IDEntifications database More...PRIDEi | P16410 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 53354 53355 [P16410-2] 53356 [P16410-3] 53357 [P16410-4] |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | P16410 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | P16410 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"CTLA-4 and CD28 activated lymphocyte molecules are closely related in both mouse and human as to sequence, message expression, gene structure, and chromosomal location."
Harper K., Balzano C., Rouvier E., Mattei M.-G., Luciani M.-F., Golstein P.
J. Immunol. 147:1037-1044(1991) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), TISSUE SPECIFICITY, ALTERNATIVE SPLICING, VARIANT ALA-17. - Ref.10"Complete sequence determination of the mouse and human CTLA4 gene loci: cross-species DNA sequence similarity beyond exon borders."
Ling V., Wu P.W., Finnerty H.F., Sharpe A.H., Gray G.S., Collins M.
Genomics 60:341-355(1999) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 140-223, TISSUE SPECIFICITY. - Ref.17"A molecular perspective of CTLA-4 function."
Teft W.A., Kirchhof M.G., Madrenas J.
Annu. Rev. Immunol. 24:65-97(2006) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, TISSUE SPECIFICITY.
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000163599 |
CleanEx database of gene expression profiles More...CleanExi | HS_CTLA4 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | P16410 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | P16410 HS |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.21"Structural basis for co-stimulation by the human CTLA-4/B7-2 complex."
Schwartz J.C., Zhang X., Fedorov A.A., Nathenson S.G., Almo S.C.
Nature 410:604-608(2001) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (3.2 ANGSTROMS) OF 36-161 IN COMPLEX WITH CD86, SUBUNIT, DISULFIDE BONDS. - Ref.22"Crystal structure of the B7-1/CTLA-4 complex that inhibits human immune responses."
Stamper C.C., Zhang Y., Tobin J.F., Erbe D.V., Ikemizu S., Davis S.J., Stahl M.L., Seehra J., Somers W.S., Mosyak L.
Nature 410:608-611(2001) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 36-161 IN COMPLEX WITH CD80, SUBUNIT, DISULFIDE BONDS, GLYCOSYLATION AT ASN-113 AND ASN-145. - Ref.23"High affinity molecular recognition and functional blockade of CTLA-4 by an engineered human lipocalin."
Schonfeld D.L., Matschiner G., Chatwell L., Trentmann S., Schlehuber S., Hohlbaum A., Skerra A.
Submitted (JAN-2008) to the PDB data bankCited for: X-RAY CRYSTALLOGRAPHY (2.10 ANGSTROMS) OF 38-161, DISULFIDE BONDS, SUBUNIT. - Ref.24"Rigid-body ligand recognition drives cytotoxic T-lymphocyte antigen 4 (CTLA-4) receptor triggering."
Yu C., Sonnen A.F., George R., Dessailly B.H., Stagg L.J., Evans E.J., Orengo C.A., Stuart D.I., Ladbury J.E., Ikemizu S., Gilbert R.J., Davis S.J.
J. Biol. Chem. 286:6685-6696(2011) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 36-161, GLYCOSYLATION AT ASN-113, SUBUNIT, DISULFIDE BONDS. - Ref.25"Structural basis for cancer immunotherapy by the first-in-class checkpoint inhibitor ipilimumab."
Ramagopal U.A., Liu W., Garrett-Thomson S.C., Bonanno J.B., Yan Q., Srinivasan M., Wong S.C., Bell A., Mankikar S., Rangan V.S., Deshpande S., Korman A.J., Almo S.C.
Proc. Natl. Acad. Sci. U.S.A. 114:E4223-E4232(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (3.00 ANGSTROMS) OF 37-154 IN COMPLEX WITH THERAPEUTIC ANTIBODY IPILIMUMAB, SUBUNIT, INTERACTION WITH CD80; CD86 AND ICOSLG, SUBCELLULAR LOCATION, TOPOLOGY, DISULFIDE BONDS, MUTAGENESIS OF VAL-45; LEU-47; SER-49; ARG-70; LYS-130; GLU-132; TYR-139 AND ILE-143.
<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi
| With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CD80 | P33681 | 3 | EBI-1030991,EBI-1031024 | |
| CD86 | P42081 | 3 | EBI-1030991,EBI-1030956 | |
| PIK3R1 | P27986 | 3 | EBI-1030991,EBI-79464 |
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 107875, 109 interactors |
Database of interacting proteins More...DIPi | DIP-35607N |
The Eukaryotic Linear Motif resource for Functional Sites in Proteins More...ELMi | P16410 |
Protein interaction database and analysis system More...IntActi | P16410, 14 interactors |
Molecular INTeraction database More...MINTi | P16410 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000303939 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
Secondary structure
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 39 – 41 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 44 – 47 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 50 – 52 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 54 – 60 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 7 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 64 – 66 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 68 – 77 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 10 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 80 – 90 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 11 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 102 – 108 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 7 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 111 – 116 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 6 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 121 – 123 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 125 – 138 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 14 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 140 – 143 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 147 – 150 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 156 – 158 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P16410 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P16410 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Miscellaneous databases
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | P16410 |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Domains and Repeats
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini | 39 – 140 | Ig-like V-typeAdd BLAST | 102 |
Region
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni | 46 – 50 | Homodimerization1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 5 | |
| <p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni | 134 – 139 | Important for interaction with CD80 and CD861 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 6 | |
| <p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni | 150 – 155 | Homodimerization2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 6 |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini
Immunoglobulin domain, Signal, Transmembrane, Transmembrane helixPhylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG410IJ05 Eukaryota ENOG410YUQR LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00530000063873 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000112047 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG057978 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P16410 |
KEGG Orthology (KO) More...KOi | K06538 |
Identification of Orthologs from Complete Genome Data More...OMAi | FSKGMHV |
Database of Orthologous Groups More...OrthoDBi | EOG091G0IGY |
Database for complete collections of gene phylogenies More...PhylomeDBi | P16410 |
TreeFam database of animal gene trees More...TreeFami | TF335679 |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 2.60.40.10, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR008096 CTLA4 IPR036179 Ig-like_dom_sf IPR013783 Ig-like_fold IPR003599 Ig_sub IPR013106 Ig_V-set |
The PANTHER Classification System More...PANTHERi | PTHR11494:SF8 PTHR11494:SF8, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF07686 V-set, 1 hit |
Protein Motif fingerprint database; a protein domain database More...PRINTSi | PR01720 CTLANTIGEN4 |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00409 IG, 1 hit SM00406 IGv, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF48726 SSF48726, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.
This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basketAdded to basket
This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
10 20 30 40 50
MACLGFQRHK AQLNLATRTW PCTLLFFLLF IPVFCKAMHV AQPAVVLASS
60 70 80 90 100
RGIASFVCEY ASPGKATEVR VTVLRQADSQ VTEVCAATYM MGNELTFLDD
110 120 130 140 150
SICTGTSSGN QVNLTIQGLR AMDTGLYICK VELMYPPPYY LGIGNGTQIY
160 170 180 190 200
VIDPEPCPDS DFLLWILAAV SSGLFFYSFL LTAVSLSKML KKRSPLTTGV
210 220
YVKMPPTEPE CEKQFQPYFI PIN
The sequence of this isoform differs from the canonical sequence as follows:
38-204: Missing.
10 20 30 40 50
MACLGFQRHK AQLNLATRTW PCTLLFFLLF IPVFCKAPPT EPECEKQFQP
YFIPIN
The sequence of this isoform differs from the canonical sequence as follows:
38-204: Missing.
205-223: PPTEPECEKQFQPYFIPIN → KEKKPSYNRGLCENAPNRARM
10 20 30 40 50
MACLGFQRHK AQLNLATRTW PCTLLFFLLF IPVFCKAKEK KPSYNRGLCE
NAPNRARM
The sequence of this isoform differs from the canonical sequence as follows:
58-58: C → S
59-204: Missing.
205-223: PPTEPECEKQFQPYFIPIN → KEKKPSYNRGLCENAPNRARM
10 20 30 40 50
MACLGFQRHK AQLNLATRTW PCTLLFFLLF IPVFCKAMHV AQPAVVLASS
60 70
RGIASFVSKE KKPSYNRGLC ENAPNRARM
The sequence of this isoform differs from the canonical sequence as follows:
153-174: DPEPCPDSDFLLWILAAVSSGL → AKEKKPSYNRGLCENAPNRARM
175-223: Missing.
10 20 30 40 50
MACLGFQRHK AQLNLATRTW PCTLLFFLLF IPVFCKAMHV AQPAVVLASS
60 70 80 90 100
RGIASFVCEY ASPGKATEVR VTVLRQADSQ VTEVCAATYM MGNELTFLDD
110 120 130 140 150
SICTGTSSGN QVNLTIQGLR AMDTGLYICK VELMYPPPYY LGIGNGTQIY
160 170
VIAKEKKPSY NRGLCENAPN RARM
Experimental Info
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti | 37 | A → V in ABG85285 (PubMed:18595775).Curated | 1 | |
| <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti | 147 | T → A in AAA52773 (PubMed:3220103).Curated | 1 |
<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi
Online Mendelian Inheritance in Man (OMIM)
More...MIMi:610424] (PubMed:15452244).10 Publications<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.3"Identification of CTLA-4 isoforms produced by alternative splicing and their association with myasthenia gravis."
Gu M., Kakoulidou M., Giscombe R., Pirskanen R., Lefvert A.K., Klareskog L., Wang X.
Clin. Immunol. 128:374-381(2008) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), VARIANT ALA-17, ALTERNATIVE SPLICING, POLYMORPHISM. - Ref.15"Association of the T-cell regulatory gene CTLA4 with susceptibility to autoimmune disease."
Ueda H., Howson J.M., Esposito L., Heward J., Snook H., Chamberlain G., Rainbow D.B., Hunter K.M., Smith A.N., Di Genova G., Herr M.H., Dahlman I., Payne F., Smyth D., Lowe C., Twells R.C., Howlett S., Healy B. , Nutland S., Rance H.E., Everett V., Smink L.J., Lam A.C., Cordell H.J., Walker N.M., Bordin C., Hulme J., Motzo C., Cucca F., Hess J.F., Metzker M.L., Rogers J., Gregory S., Allahabadia A., Nithiyananthan R., Tuomilehto-Wolf E., Tuomilehto J., Bingley P., Gillespie K.M., Undlien D.E., Ronningen K.S., Guja C., Ionescu-Tirgoviste C., Savage D.A., Maxwell A.P., Carson D.J., Patterson C.C., Franklyn J.A., Clayton D.G., Peterson L.B., Wicker L.S., Todd J.A., Gough S.C.
Nature 423:506-511(2003) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM. - Ref.27"CTLA-4 gene polymorphism is associated with predisposition to coeliac disease."
Djilali-Saiah I., Schmitz J., Harfouch-Hammoud E., Mougenot J.-F., Bach J.-F., Caillat-Zucman S.
Gut 43:187-189(1998) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM, INVOLVEMENT IN CELIAC3. - Ref.29"Complex association analysis of Graves disease using a set of polymorphic markers."
Chistyakov D.A., Savost'anov K.V., Turakulov R.I., Petunina N.A., Trukhina L.V., Kudinova A.V., Balabolkin M.I., Nosikov V.V.
Mol. Genet. Metab. 70:214-218(2000) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM, VARIANT ALA-17, INVOLVEMENT IN GRAVES DISEASE. - Ref.31"Evidence for CTLA4 as a susceptibility gene for systemic lupus erythematosus."
Barreto M., Santos E., Ferreira R., Fesel C., Fontes M.F., Pereira C., Martins B., Andreia R., Viana J.F., Crespo F., Vasconcelos C., Ferreira C., Vicente A.M.
Eur. J. Hum. Genet. 12:620-626(2004) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM, INVOLVEMENT IN SYSTEMIC LUPUS ERYTHEMATOSUS. - Ref.32"Cytotoxic T-lymphocyte antigen 4 gene and recovery from hepatitis B virus infection."
Thio C.L., Mosbruger T.L., Kaslow R.A., Karp C.L., Strathdee S.A., Vlahov D., O'Brien S.J., Astemborski J., Thomas D.L.
J. Virol. 78:11258-11262(2004) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM, INVOLVEMENT IN SUSCEPTIBILITY TO HBV INFECTION, VARIANT ALA-17. - Ref.33"A common CTLA4 haplotype associated with coeliac disease."
Hunt K.A., McGovern D.P.B., Kumar P.J., Ghosh S., Travis S.P.L., Walters J.R.F., Jewell D.P., Playford R.J., van Heel D.A.
Eur. J. Hum. Genet. 13:440-444(2005) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM, INVOLVEMENT IN CELIAC3. - Ref.34"CTLA-4 polymorphisms and systemic lupus erythematosus (SLE): a meta-analysis."
Lee Y.H., Harley J.B., Nath S.K.
Hum. Genet. 116:361-367(2005) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM, INVOLVEMENT IN SYSTEMIC LUPUS ERYTHEMATOSUS. - Ref.35"Autosomal dominant immune dysregulation syndrome in humans with CTLA4 mutations."
Schubert D., Bode C., Kenefeck R., Hou T.Z., Wing J.B., Kennedy A., Bulashevska A., Petersen B.S., Schaeffer A.A., Gruening B.A., Unger S., Frede N., Baumann U., Witte T., Schmidt R.E., Dueckers G., Niehues T., Seneviratne S. , Kanariou M., Speckmann C., Ehl S., Rensing-Ehl A., Warnatz K., Rakhmanov M., Thimme R., Hasselblatt P., Emmerich F., Cathomen T., Backofen R., Fisch P., Seidl M., May A., Schmitt-Graeff A., Ikemizu S., Salzer U., Franke A., Sakaguchi S., Walker L.S., Sansom D.M., Grimbacher B.
Nat. Med. 20:1410-1416(2014) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM, INVOLVEMENT IN ALPS5, VARIANT ALPS5 TRP-70. - Ref.36"Immune dysregulation in human subjects with heterozygous germline mutations in CTLA4."
Kuehn H.S., Ouyang W., Lo B., Deenick E.K., Niemela J.E., Avery D.T., Schickel J.N., Tran D.Q., Stoddard J., Zhang Y., Frucht D.M., Dumitriu B., Scheinberg P., Folio L.R., Frein C.A., Price S., Koh C., Heller T. , Seroogy C.M., Huttenlocher A., Rao V.K., Su H.C., Kleiner D., Notarangelo L.D., Rampertaap Y., Olivier K.N., McElwee J., Hughes J., Pittaluga S., Oliveira J.B., Meffre E., Fleisher T.A., Holland S.M., Lenardo M.J., Tangye S.G., Uzel G.
Science 345:1623-1627(2014) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM, INVOLVEMENT IN ALPS5.
Natural variant
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_013577 | 17 | T → A Increased risk for Graves disease, insulin-dependent diabetes mellitus, thyroid-associated orbitopathy, systemic lupus erythematosus and susceptibility to HBV infection. 7 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_072681 | 70 | R → W in ALPS5. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
Alternative sequence
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_041284 | 38 – 204 | Missing in isoform 2 and isoform 3. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 167 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_041285 | 58 | C → S in isoform 4. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_041286 | 59 – 204 | Missing in isoform 4. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 146 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047238 | 153 – 174 | DPEPC…VSSGL → AKEKKPSYNRGLCENAPNRA RM in isoform 5. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini | 22 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047239 | 175 – 223 | Missing in isoform 5. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini | 49 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_041287 | 205 – 223 | PPTEP…FIPIN → KEKKPSYNRGLCENAPNRAR M in isoform 3 and isoform 4. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 19 |
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | L15006 mRNA Translation: AAB59385.1 M74363 Genomic DNA Translation: AAA52127.1 AF411058 Genomic DNA Translation: AAL40932.1 AY792514 mRNA Translation: AAV66331.1 AY999702 mRNA Translation: AAY00166.1 DQ785106 mRNA Translation: ABG85285.1 AF414120 mRNA Translation: AAL07473.1 DQ357942 Genomic DNA Translation: ABC67470.1 AC010138 Genomic DNA Translation: AAX93176.1 BC074842 mRNA Translation: AAH74842.1 BC074893 mRNA Translation: AAH74893.1 AH002733 Genomic DNA Translation: AAA52773.1 U90273 mRNA Translation: AAD00698.1 AF142144 Genomic DNA Translation: AAF02499.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS2362.1 [P16410-1] CCDS42803.1 [P16410-5] |
Protein sequence database of the Protein Information Resource More...PIRi | S08614 |
NCBI Reference Sequences More...RefSeqi | NP_001032720.1, NM_001037631.2 [P16410-5] NP_005205.2, NM_005214.4 [P16410-1] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.247824 |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000295854; ENSP00000295854; ENSG00000163599 [P16410-5] ENST00000302823; ENSP00000303939; ENSG00000163599 [P16410-1] ENST00000472206; ENSP00000417779; ENSG00000163599 [P16410-4] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 1493 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:1493 |
UCSC genome browser More...UCSCi | uc002vak.3 human [P16410-1] |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi
Alternative splicing, Polymorphism<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi
| Wikipedia CLTA-4 entry |
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | L15006 mRNA Translation: AAB59385.1 M74363 Genomic DNA Translation: AAA52127.1 AF411058 Genomic DNA Translation: AAL40932.1 AY792514 mRNA Translation: AAV66331.1 AY999702 mRNA Translation: AAY00166.1 DQ785106 mRNA Translation: ABG85285.1 AF414120 mRNA Translation: AAL07473.1 DQ357942 Genomic DNA Translation: ABC67470.1 AC010138 Genomic DNA Translation: AAX93176.1 BC074842 mRNA Translation: AAH74842.1 BC074893 mRNA Translation: AAH74893.1 AH002733 Genomic DNA Translation: AAA52773.1 U90273 mRNA Translation: AAD00698.1 AF142144 Genomic DNA Translation: AAF02499.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS2362.1 [P16410-1] CCDS42803.1 [P16410-5] |
Protein sequence database of the Protein Information Resource More...PIRi | S08614 |
NCBI Reference Sequences More...RefSeqi | NP_001032720.1, NM_001037631.2 [P16410-5] NP_005205.2, NM_005214.4 [P16410-1] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.247824 |
3D structure databases
| Select the link destinations: Protein Data Bank Europe More...PDBeiProtein Data Bank RCSB More...RCSB PDBiProtein Data Bank Japan More...PDBjiLinks Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
| 1AH1 | NMR | - | A | 37-161 | [»] | |
| 1H6E | X-ray | 3.60 | P | 197-207 | [»] | |
| 1I85 | X-ray | 3.20 | C/D | 36-161 | [»] | |
| 1I8L | X-ray | 3.00 | C/D | 36-161 | [»] | |
| 2X44 | X-ray | 2.60 | D | 36-161 | [»] | |
| 3BX7 | X-ray | 2.10 | C | 38-161 | [»] | |
| 3OSK | X-ray | 1.80 | A/B | 36-161 | [»] | |
| 5GGV | X-ray | 2.00 | Y | 36-161 | [»] | |
| 5TRU | X-ray | 3.00 | C/c | 37-154 | [»] | |
| 5XJ3 | X-ray | 3.20 | C/F/I/L | 36-161 | [»] | |
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P16410 | |||||
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P16410 | |||||
Database of comparative protein structure models More...ModBasei | Search... | |||||
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... | |||||
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 107875, 109 interactors |
Database of interacting proteins More...DIPi | DIP-35607N |
The Eukaryotic Linear Motif resource for Functional Sites in Proteins More...ELMi | P16410 |
Protein interaction database and analysis system More...IntActi | P16410, 14 interactors |
Molecular INTeraction database More...MINTi | P16410 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000303939 |
Chemistry databases
ChEMBL database of bioactive drug-like small molecules More...ChEMBLi | CHEMBL2364164 |
Drug and drug target database More...DrugBanki | DB06186 Ipilimumab |
IUPHAR/BPS Guide to PHARMACOLOGY More...GuidetoPHARMACOLOGYi | 2743 |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | P16410 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | P16410 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | CTLA4 |
Domain mapping of disease mutations (DMDM) More...DMDMi | 27735177 |
Proteomic databases
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P16410 |
PeptideAtlas More...PeptideAtlasi | P16410 |
PRoteomics IDEntifications database More...PRIDEi | P16410 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 53354 53355 [P16410-2] 53356 [P16410-3] 53357 [P16410-4] |
Protocols and materials databases
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000295854; ENSP00000295854; ENSG00000163599 [P16410-5] ENST00000302823; ENSP00000303939; ENSG00000163599 [P16410-1] ENST00000472206; ENSP00000417779; ENSG00000163599 [P16410-4] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 1493 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:1493 |
UCSC genome browser More...UCSCi | uc002vak.3 human [P16410-1] |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 1493 |
DisGeNET More...DisGeNETi | 1493 |
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000163599.14 |
GeneCards: human genes, protein and diseases More...GeneCardsi | CTLA4 |
Human Gene Nomenclature Database More...HGNCi | HGNC:2505 CTLA4 |
MalaCards human disease database More...MalaCardsi | CTLA4 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 109100 phenotype 123890 gene 152700 phenotype 601388 phenotype 609755 phenotype 610424 phenotype 616100 phenotype |
neXtProt; the human protein knowledge platform More...neXtProti | NX_P16410 |
Open Targets More...OpenTargetsi | ENSG00000163599 |
Orphanet; a database dedicated to information on rare diseases and orphan drugs More...Orphaneti | 555 Celiac disease 900 Granulomatosis with polyangiitis 855 Hashimoto struma 536 Systemic lupus erythematosus |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA27006 |
GenAtlas: human gene database More...GenAtlasi | Search... |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG410IJ05 Eukaryota ENOG410YUQR LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00530000063873 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000112047 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG057978 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P16410 |
KEGG Orthology (KO) More...KOi | K06538 |
Identification of Orthologs from Complete Genome Data More...OMAi | FSKGMHV |
Database of Orthologous Groups More...OrthoDBi | EOG091G0IGY |
Database for complete collections of gene phylogenies More...PhylomeDBi | P16410 |
TreeFam database of animal gene trees More...TreeFami | TF335679 |
Enzyme and pathway databases
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-HSA-389513 CTLA4 inhibitory signaling R-HSA-8877330 RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs) |
SIGNOR Signaling Network Open Resource More...SIGNORi | P16410 |
Miscellaneous databases
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | P16410 |
The Gene Wiki collection of pages on human genes and proteins More...GeneWikii | CTLA-4 |
Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens More...GenomeRNAii | 1493 |
Protein Ontology More...PROi | PR:P16410 |
The Stanford Online Universal Resource for Clones and ESTs More...SOURCEi | Search... |
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000163599 |
CleanEx database of gene expression profiles More...CleanExi | HS_CTLA4 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | P16410 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | P16410 HS |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 2.60.40.10, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR008096 CTLA4 IPR036179 Ig-like_dom_sf IPR013783 Ig-like_fold IPR003599 Ig_sub IPR013106 Ig_V-set |
The PANTHER Classification System More...PANTHERi | PTHR11494:SF8 PTHR11494:SF8, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF07686 V-set, 1 hit |
Protein Motif fingerprint database; a protein domain database More...PRINTSi | PR01720 CTLANTIGEN4 |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00409 IG, 1 hit SM00406 IGv, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF48726 SSF48726, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | CTLA4_HUMAN | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | P16410Primary (citable) accession number: P16410 Secondary accession number(s): A0N1S0 , E9PDH0, O95653, Q0PP65, Q52MC1, Q53TD5, Q5S005, Q8WXJ1, Q96P43, Q9UKN9 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | August 1, 1990 |
| Last sequence update: | January 10, 2003 | |
| Last modified: | July 18, 2018 | |
| This is version 202 of the entry and version 3 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Chordata Protein Annotation Program | |
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
3D-structure, Complete proteome, Pharmaceutical, Reference proteomeDocuments
- Human cell differentiation molecules
CD nomenclature of surface proteins of human leucocytes and list of entries - Human chromosome 2
Human chromosome 2: entries, gene names and cross-references to MIM - Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations - Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - PDB cross-references
Index of Protein Data Bank (PDB) cross-references
