Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Integrin beta-4

Gene

ITGB4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Integrin alpha-6/beta-4 is a receptor for laminin. Plays a critical structural role in the hemidesmosome of epithelial cells. Is required for the regulation of keratinocyte polarity and motility. ITGA6:ITGB4 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling (PubMed:20682778). ITGA6:ITGB4 binds to IGF1 and this binding is essential for IGF1 signaling (PubMed:22351760). ITGA6:ITGB4 binds to IGF2 and this binding is essential for IGF2 signaling (PubMed:28873464).5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • G protein-coupled receptor binding Source: UniProtKB
  • integrin binding Source: GO_Central

GO - Biological processi

  • amelogenesis Source: UniProtKB
  • autophagy Source: UniProtKB
  • cell adhesion Source: ProtInc
  • cell adhesion mediated by integrin Source: GO_Central
  • cell-matrix adhesion Source: UniProtKB
  • cell migration Source: GO_Central
  • cell motility Source: UniProtKB
  • digestive tract development Source: UniProtKB
  • extracellular matrix organization Source: Reactome
  • hemidesmosome assembly Source: UniProtKB
  • integrin-mediated signaling pathway Source: GO_Central
  • mesodermal cell differentiation Source: UniProtKB
  • nail development Source: UniProtKB
  • renal system development Source: UniProtKB
  • response to wounding Source: UniProtKB
  • skin development Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIntegrin, Receptor
Biological processCell adhesion

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2022090 Assembly of collagen fibrils and other multimeric structures
R-HSA-3000157 Laminin interactions
R-HSA-3000170 Syndecan interactions
R-HSA-446107 Type I hemidesmosome assembly

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P16144

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P16144

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Integrin beta-4
Alternative name(s):
GP150
CD_antigen: CD104
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ITGB4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000132470.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6158 ITGB4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
147557 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P16144

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini28 – 710ExtracellularSequence analysisAdd BLAST683
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei711 – 733HelicalSequence analysisAdd BLAST23
Topological domaini734 – 1822CytoplasmicSequence analysisAdd BLAST1089

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Epidermolysis bullosa letalis, with pyloric atresia (EB-PA)7 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive, frequently lethal, epidermolysis bullosa with variable involvement of skin, nails, mucosa, and with variable effects on the digestive system. It is characterized by mucocutaneous fragility, aplasia cutis congenita, and gastrointestinal atresia, which most commonly affects the pylorus. Pyloric atresia is a primary manifestation rather than a scarring process secondary to epidermolysis bullosa.
See also OMIM:226730
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01065238C → R in EB-PA; mild form. 1 PublicationCorresponds to variant dbSNP:rs121912465EnsemblClinVar.1
Natural variantiVAR_00400661C → Y in EB-PA; lethal form. 1 PublicationCorresponds to variant dbSNP:rs80338755EnsemblClinVar.1
Natural variantiVAR_011293131D → Y in EB-PA; lethal form. 1 Publication1
Natural variantiVAR_004007156L → P in EB-PA; mild form. 1 PublicationCorresponds to variant dbSNP:rs121912461EnsemblClinVar.1
Natural variantiVAR_004008245C → G in EB-PA; lethal form. 1 Publication1
Natural variantiVAR_004009252R → C in EB-PA; mild form. 2 PublicationsCorresponds to variant dbSNP:rs201494421Ensembl.1
Natural variantiVAR_011294273G → D in EB-PA; lethal form. 1 PublicationCorresponds to variant dbSNP:rs1476568580Ensembl.1
Natural variantiVAR_011295283R → C in EB-PA. 1 PublicationCorresponds to variant dbSNP:rs1422797135Ensembl.1
Natural variantiVAR_011296325V → D in EB-PA. 1 Publication1
Natural variantiVAR_011297336L → P in EB-PA; mild form. 1 Publication1
Natural variantiVAR_004010562C → R in EB-PA; mild form. 1 PublicationCorresponds to variant dbSNP:rs121912463EnsemblClinVar.1
Natural variantiVAR_0113011225R → H in EB-PA; mild form. 1 PublicationCorresponds to variant dbSNP:rs121912468EnsemblClinVar.1
Natural variantiVAR_0040111281R → W in EB-PA; mild form; abolishes interaction with PLEC and reduces interaction with COL17A1. 3 PublicationsCorresponds to variant dbSNP:rs121912467EnsemblClinVar.1
Generalized atrophic benign epidermolysis bullosa (GABEB)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA non-lethal, adult form of junctional epidermolysis bullosa characterized by life-long blistering of the skin, associated with hair and tooth abnormalities.
See also OMIM:226650
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_011299931G → D in GABEB. 1 PublicationCorresponds to variant dbSNP:rs121912466EnsemblClinVar.1
Epidermolysis bullosa simplex, Weber-Cockayne type (WC-EBS)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of intraepidermal epidermolysis bullosa characterized by blistering limited to palmar and plantar areas of the skin.
See also OMIM:131800

Keywords - Diseasei

Disease mutation, Epidermolysis bullosa

Organism-specific databases

DisGeNET

More...
DisGeNETi
3691

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
ITGB4

MalaCards human disease database

More...
MalaCardsi
ITGB4
MIMi131800 phenotype
226650 phenotype
226730 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000132470

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
158684 Epidermolysis bullosa simplex with pyloric atresia
79402 Junctional epidermolysis bullosa, generalized intermediate
79403 Junctional epidermolysis bullosa-pyloric atresia syndrome
251393 Localized junctional epidermolysis bullosa, non-Herlitz type

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29957

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB05122 R1295

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ITGB4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
317373584

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 271 PublicationAdd BLAST27
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001634628 – 1822Integrin beta-4Add BLAST1795

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi30 ↔ 455By similarity
Disulfide bondi38 ↔ 48By similarity
Disulfide bondi41 ↔ 72By similarity
Disulfide bondi51 ↔ 61By similarity
Disulfide bondi245 ↔ 288By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi327N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi424 ↔ 671By similarity
Disulfide bondi452 ↔ 457By similarity
Disulfide bondi468 ↔ 479By similarity
Disulfide bondi476 ↔ 512By similarity
Disulfide bondi481 ↔ 490By similarity
Glycosylationi491N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi492 ↔ 503By similarity
Disulfide bondi518 ↔ 523By similarity
Disulfide bondi520 ↔ 551By similarity
Disulfide bondi525 ↔ 536By similarity
Disulfide bondi557 ↔ 562By similarity
Disulfide bondi564 ↔ 573By similarity
Disulfide bondi575 ↔ 582By similarity
Glycosylationi579N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi596 ↔ 601By similarity
Disulfide bondi598 ↔ 648By similarity
Disulfide bondi603 ↔ 614By similarity
Glycosylationi617N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi626 ↔ 635By similarity
Disulfide bondi632 ↔ 706By similarity
Disulfide bondi651 ↔ 680By similarity
Glycosylationi695N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei771PhosphoserineBy similarity1
Modified residuei1069PhosphoserineCombined sources1
Modified residuei1119PhosphoserineBy similarity1
Modified residuei1454PhosphoserineCombined sources1
Modified residuei1457PhosphoserineCombined sources1
Modified residuei1474PhosphoserineCombined sources1
Modified residuei1487PhosphothreonineCombined sources1
Modified residuei1494PhosphoserineBy similarity1
Modified residuei1530PhosphothreonineCombined sources1
Modified residuei1791PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylated by DHHC3 at several cysteines of the membrane-proximal region, enhancing stability and cell surface expression. Palmitoylation also promotes secundary association with tertaspanins.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P16144

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P16144

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P16144

PeptideAtlas

More...
PeptideAtlasi
P16144

PRoteomics IDEntifications database

More...
PRIDEi
P16144

ProteomicsDB human proteome resource

More...
ProteomicsDBi
53292
53293 [P16144-2]
53294 [P16144-3]
53295 [P16144-4]
53296 [P16144-5]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1417

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P16144

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P16144

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P16144

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Integrin alpha-6/beta-4 is predominantly expressed by epithelia. Isoform beta-4D is also expressed in colon and placenta. Isoform beta-4E is also expressed in epidermis, lung, duodenum, heart, spleen and stomach.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000132470 Expressed in 215 organ(s), highest expression level in tibial nerve

CleanEx database of gene expression profiles

More...
CleanExi
HS_ITGB4

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P16144 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P16144 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB002422
CAB005258
HPA036348
HPA036349

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of an alpha and a beta subunit. Beta-4 associates with alpha-6. Interacts (via cytoplasmic region) with COL17A1 (via cytoplasmic region). Interacts (via cytoplasmic region) with DST isoform 3 (via N-terminus). Isoform beta-4a interacts (via cytoplasmic domain) with DST (via N-terminus). Interacts with RAC1. ITGA6:ITGB4 is found in a ternary complex with NRG1 and ERBB3 (PubMed:20682778). ITGA6:ITGB4 is found in a ternary complex with IGF1 and IGF1R (PubMed:22351760). ITGA6:ITGB4 interacts with IGF2 (PubMed:28873464).7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109897, 36 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1822 Integrin alpha6-beta4 complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P16144

Database of interacting proteins

More...
DIPi
DIP-40182N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P16144

Protein interaction database and analysis system

More...
IntActi
P16144, 87 interactors

Molecular INTeraction database

More...
MINTi
P16144

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000200181

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11822
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P16144

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P16144

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P16144

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini29 – 73PSIAdd BLAST45
Domaini131 – 329VWFAAdd BLAST199
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati456 – 502IAdd BLAST47
Repeati503 – 542IIAdd BLAST40
Repeati543 – 581IIIAdd BLAST39
Repeati582 – 619IVAdd BLAST38
Domaini979 – 1084Calx-betaAdd BLAST106
Domaini1129 – 1218Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST90
Domaini1222 – 1321Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST100
Domaini1530 – 1625Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST96
Domaini1643 – 1739Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST97

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni194 – 199Involved in NRG1- and IGF1-binding2 Publications6
Regioni456 – 619Cysteine-rich tandem repeatsAdd BLAST164
Regioni732 – 749Palmitoylated on several cysteinesAdd BLAST18

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The fibronectin type-III-like domains bind BPAG1 and plectin and probably also recruit BP230.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the integrin beta chain family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1226 Eukaryota
ENOG410XP60 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153730

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231105

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG006189

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P16144

KEGG Orthology (KO)

More...
KOi
K06525

Identification of Orthologs from Complete Genome Data

More...
OMAi
KVKYWIQ

Database of Orthologous Groups

More...
OrthoDBi
EOG091G029W

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P16144

TreeFam database of animal gene trees

More...
TreeFami
TF105392

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063 FN3, 4 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 4 hits
2.60.40.2030, 1 hit
3.40.50.410, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR038081 CalX-like_sf
IPR003644 Calx_beta
IPR013032 EGF-like_CS
IPR013111 EGF_extracell
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
IPR033760 Integrin_beta_N
IPR015812 Integrin_bsu
IPR012013 Integrin_bsu-4
IPR012896 Integrin_bsu_tail
IPR036349 Integrin_bsu_tail_dom_sf
IPR002369 Integrin_bsu_VWA
IPR016201 PSI
IPR036465 vWFA_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10082 PTHR10082, 1 hit
PTHR10082:SF42 PTHR10082:SF42, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03160 Calx-beta, 1 hit
PF07974 EGF_2, 1 hit
PF00041 fn3, 4 hits
PF07965 Integrin_B_tail, 1 hit
PF00362 Integrin_beta, 1 hit
PF17205 PSI_integrin, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF002513 Integrin_B4, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01186 INTEGRINB

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00237 Calx_beta, 1 hit
SM00060 FN3, 4 hits
SM00187 INB, 1 hit
SM01242 Integrin_B_tail, 1 hit
SM00423 PSI, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF141072 SSF141072, 1 hit
SSF49265 SSF49265, 2 hits
SSF53300 SSF53300, 1 hit
SSF69687 SSF69687, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00022 EGF_1, 2 hits
PS01186 EGF_2, 2 hits
PS50853 FN3, 4 hits
PS00243 INTEGRIN_BETA, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform Beta-4C (identifier: P16144-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGPRPSPWA RLLLAALISV SLSGTLANRC KKAPVKSCTE CVRVDKDCAY
60 70 80 90 100
CTDEMFRDRR CNTQAELLAA GCQRESIVVM ESSFQITEET QIDTTLRRSQ
110 120 130 140 150
MSPQGLRVRL RPGEERHFEL EVFEPLESPV DLYILMDFSN SMSDDLDNLK
160 170 180 190 200
KMGQNLARVL SQLTSDYTIG FGKFVDKVSV PQTDMRPEKL KEPWPNSDPP
210 220 230 240 250
FSFKNVISLT EDVDEFRNKL QGERISGNLD APEGGFDAIL QTAVCTRDIG
260 270 280 290 300
WRPDSTHLLV FSTESAFHYE ADGANVLAGI MSRNDERCHL DTTGTYTQYR
310 320 330 340 350
TQDYPSVPTL VRLLAKHNII PIFAVTNYSY SYYEKLHTYF PVSSLGVLQE
360 370 380 390 400
DSSNIVELLE EAFNRIRSNL DIRALDSPRG LRTEVTSKMF QKTRTGSFHI
410 420 430 440 450
RRGEVGIYQV QLRALEHVDG THVCQLPEDQ KGNIHLKPSF SDGLKMDAGI
460 470 480 490 500
ICDVCTCELQ KEVRSARCSF NGDFVCGQCV CSEGWSGQTC NCSTGSLSDI
510 520 530 540 550
QPCLREGEDK PCSGRGECQC GHCVCYGEGR YEGQFCEYDN FQCPRTSGFL
560 570 580 590 600
CNDRGRCSMG QCVCEPGWTG PSCDCPLSNA TCIDSNGGIC NGRGHCECGR
610 620 630 640 650
CHCHQQSLYT DTICEINYSA IHPGLCEDLR SCVQCQAWGT GEKKGRTCEE
660 670 680 690 700
CNFKVKMVDE LKRAEEVVVR CSFRDEDDDC TYSYTMEGDG APGPNSTVLV
710 720 730 740 750
HKKKDCPPGS FWWLIPLLLL LLPLLALLLL LCWKYCACCK ACLALLPCCN
760 770 780 790 800
RGHMVGFKED HYMLRENLMA SDHLDTPMLR SGNLKGRDVV RWKVTNNMQR
810 820 830 840 850
PGFATHAASI NPTELVPYGL SLRLARLCTE NLLKPDTREC AQLRQEVEEN
860 870 880 890 900
LNEVYRQISG VHKLQQTKFR QQPNAGKKQD HTIVDTVLMA PRSAKPALLK
910 920 930 940 950
LTEKQVEQRA FHDLKVAPGY YTLTADQDAR GMVEFQEGVE LVDVRVPLFI
960 970 980 990 1000
RPEDDDEKQL LVEAIDVPAG TATLGRRLVN ITIIKEQARD VVSFEQPEFS
1010 1020 1030 1040 1050
VSRGDQVARI PVIRRVLDGG KSQVSYRTQD GTAQGNRDYI PVEGELLFQP
1060 1070 1080 1090 1100
GEAWKELQVK LLELQEVDSL LRGRQVRRFH VQLSNPKFGA HLGQPHSTTI
1110 1120 1130 1140 1150
IIRDPDELDR SFTSQMLSSQ PPPHGDLGAP QNPNAKAAGS RKIHFNWLPP
1160 1170 1180 1190 1200
SGKPMGYRVK YWIQGDSESE AHLLDSKVPS VELTNLYPYC DYEMKVCAYG
1210 1220 1230 1240 1250
AQGEGPYSSL VSCRTHQEVP SEPGRLAFNV VSSTVTQLSW AEPAETNGEI
1260 1270 1280 1290 1300
TAYEVCYGLV NDDNRPIGPM KKVLVDNPKN RMLLIENLRE SQPYRYTVKA
1310 1320 1330 1340 1350
RNGAGWGPER EAIINLATQP KRPMSIPIIP DIPIVDAQSG EDYDSFLMYS
1360 1370 1380 1390 1400
DDVLRSPSGS QRPSVSDDTG CGWKFEPLLG EELDLRRVTW RLPPELIPRL
1410 1420 1430 1440 1450
SASSGRSSDA EAPHGPPDDG GAGGKGGSLP RSATPGPPGE HLVNGRMDFA
1460 1470 1480 1490 1500
FPGSTNSLHR MTTTSAAAYG THLSPHVPHR VLSTSSTLTR DYNSLTRSEH
1510 1520 1530 1540 1550
SHSTTLPRDY STLTSVSSHD SRLTAGVPDT PTRLVFSALG PTSLRVSWQE
1560 1570 1580 1590 1600
PRCERPLQGY SVEYQLLNGG ELHRLNIPNP AQTSVVVEDL LPNHSYVFRV
1610 1620 1630 1640 1650
RAQSQEGWGR EREGVITIES QVHPQSPLCP LPGSAFTLST PSAPGPLVFT
1660 1670 1680 1690 1700
ALSPDSLQLS WERPRRPNGD IVGYLVTCEM AQGGGPATAF RVDGDSPESR
1710 1720 1730 1740 1750
LTVPGLSENV PYKFKVQART TEGFGPEREG IITIESQDGG PFPQLGSRAG
1760 1770 1780 1790 1800
LFQHPLQSEY SSITTTHTSA TEPFLVDGLT LGAQHLEAGG SLTRHVTQEF
1810 1820
VSRTLTTSGT LSTHMDQQFF QT
Length:1,822
Mass (Da):202,167
Last modified:January 11, 2011 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i09710FFBBD719469
GO
Isoform Beta-4A (identifier: P16144-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1370-1439: Missing.

Show »
Length:1,752
Mass (Da):195,013
Checksum:i3C473AEFB8804093
GO
Isoform Beta-4B (identifier: P16144-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1370-1439: Missing.
     1519-1519: H → HGLPPIWEHGRSRLPLSWALGSRSRAQMKGFPPSRGPRDSIILAGRPAAPSWGP

Show »
Length:1,805
Mass (Da):200,725
Checksum:i95FEBEEBA6CA8268
GO
Isoform Beta-4D (identifier: P16144-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1370-1439: Missing.
     1678-1685: CEMAQGGG → W

Show »
Length:1,745
Mass (Da):194,466
Checksum:iAA31D59C1019CFCD
GO
Isoform Beta-4E (identifier: P16144-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     851-964: LNEVYRQISG...DDEKQLLVEA → VRTQELGLAG...GRTGAPLYPA
     965-1822: Missing.

Show »
Length:964
Mass (Da):106,779
Checksum:i498952C0EAC8EC62
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QQL2J3QQL2_HUMAN
Integrin beta
ITGB4
114Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRK0J3QRK0_HUMAN
Integrin beta-4
ITGB4
201Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSH9J3KSH9_HUMAN
Integrin beta-4
ITGB4
63Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAA37656 differs from that shown. Reason: Frameshift at positions 1413 and 1429.Curated
The sequence CAA37656 differs from that shown. Reason: Frameshift at positions 1414 and 1429.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti27Missing in CAB61345 (PubMed:9166594).Curated1
Sequence conflicti43R → Y AA sequence (PubMed:2542022).Curated1
Sequence conflicti46K → P AA sequence (PubMed:2542022).Curated1
Sequence conflicti621 – 704IHPGL…VHKKK → STRASARTYAPACSARRGAP ARRRGARVRNATSRSRWWTS LREARRWWCAAPSGTRMTTA PTATPWKVTAPLGPTALSWC TRRR in CAB61345 (PubMed:9166594).CuratedAdd BLAST84
Sequence conflicti802 – 804GFA → WLC in AAB65422 (PubMed:16625196).Curated3
Sequence conflicti1414 – 1429HGPPD…KGGSL → TAPRTTAARAGRAAAV in CAA37656 (PubMed:1976638).CuratedAdd BLAST16
Sequence conflicti1755P → L in AAI18917 (PubMed:15489334).Curated1
Sequence conflicti1777Missing in CAB61345 (PubMed:9166594).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01065238C → R in EB-PA; mild form. 1 PublicationCorresponds to variant dbSNP:rs121912465EnsemblClinVar.1
Natural variantiVAR_00400661C → Y in EB-PA; lethal form. 1 PublicationCorresponds to variant dbSNP:rs80338755EnsemblClinVar.1
Natural variantiVAR_01129298R → H1 PublicationCorresponds to variant dbSNP:rs143114124Ensembl.1
Natural variantiVAR_011293131D → Y in EB-PA; lethal form. 1 Publication1
Natural variantiVAR_004007156L → P in EB-PA; mild form. 1 PublicationCorresponds to variant dbSNP:rs121912461EnsemblClinVar.1
Natural variantiVAR_004008245C → G in EB-PA; lethal form. 1 Publication1
Natural variantiVAR_004009252R → C in EB-PA; mild form. 2 PublicationsCorresponds to variant dbSNP:rs201494421Ensembl.1
Natural variantiVAR_011294273G → D in EB-PA; lethal form. 1 PublicationCorresponds to variant dbSNP:rs1476568580Ensembl.1
Natural variantiVAR_011295283R → C in EB-PA. 1 PublicationCorresponds to variant dbSNP:rs1422797135Ensembl.1
Natural variantiVAR_011296325V → D in EB-PA. 1 Publication1
Natural variantiVAR_011297336L → P in EB-PA; mild form. 1 Publication1
Natural variantiVAR_027803478Q → H. Corresponds to variant dbSNP:rs8079267EnsemblClinVar.1
Natural variantiVAR_004010562C → R in EB-PA; mild form. 1 PublicationCorresponds to variant dbSNP:rs121912463EnsemblClinVar.1
Natural variantiVAR_011298844R → L1 PublicationCorresponds to variant dbSNP:rs140819116Ensembl.1
Natural variantiVAR_011299931G → D in GABEB. 1 PublicationCorresponds to variant dbSNP:rs121912466EnsemblClinVar.1
Natural variantiVAR_0113001216H → Q1 PublicationCorresponds to variant dbSNP:rs149284152Ensembl.1
Natural variantiVAR_0113011225R → H in EB-PA; mild form. 1 PublicationCorresponds to variant dbSNP:rs121912468EnsemblClinVar.1
Natural variantiVAR_0040111281R → W in EB-PA; mild form; abolishes interaction with PLEC and reduces interaction with COL17A1. 3 PublicationsCorresponds to variant dbSNP:rs121912467EnsemblClinVar.1
Natural variantiVAR_0559711764T → S2 PublicationsCorresponds to variant dbSNP:rs1051486Ensembl.1
Natural variantiVAR_0278041779L → P6 PublicationsCorresponds to variant dbSNP:rs871443EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_002747851 – 964LNEVY…LLVEA → VRTQELGLAGDVAERGLQAD LRCTQAPADQVPAAAQCREK ARPHHCGHSADGAPLGQAGP AEAYREAGGTEGLPRPQGGP RLLHPHCRPGRPGHGGVPGG RGAGGRTGAPLYPA in isoform Beta-4E. 1 PublicationAdd BLAST114
Alternative sequenceiVSP_002748965 – 1822Missing in isoform Beta-4E. 1 PublicationAdd BLAST858
Alternative sequenceiVSP_0027491370 – 1439Missing in isoform Beta-4A, isoform Beta-4B and isoform Beta-4D. 4 PublicationsAdd BLAST70
Alternative sequenceiVSP_0027501519H → HGLPPIWEHGRSRLPLSWAL GSRSRAQMKGFPPSRGPRDS IILAGRPAAPSWGP in isoform Beta-4B. 2 Publications1
Alternative sequenceiVSP_0027511678 – 1685CEMAQGGG → W in isoform Beta-4D. Curated8

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X51841 mRNA Translation: CAA36134.1
X52186 mRNA Translation: CAA36433.1
X53587 mRNA Translation: CAA37656.1 Frameshift.
U66541
, U66530, U66531, U66532, U66533, U66534, U66535, U66536, U66537, U66538, U66539, U66540 Genomic DNA Translation: AAC51634.1
U66541
, U66530, U66531, U66532, U66533, U66534, U66535, U66536, U66537, U66538, U66539, U66540 Genomic DNA Translation: AAC51633.1
U66541
, U66530, U66531, U66532, U66533, U66534, U66535, U66536, U66537, U66538, U66539, U66540 Genomic DNA Translation: AAC51632.1
AC087749 Genomic DNA No translation available.
CH471099 Genomic DNA Translation: EAW89305.1
BC118916 mRNA Translation: AAI18917.1
BC126411 mRNA Translation: AAI26412.1
AJ251004, Y11107 Genomic DNA Translation: CAB61345.1
AF011375 mRNA Translation: AAB65421.1
AF011376 Genomic DNA Translation: AAB65422.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11727.1 [P16144-1]
CCDS32736.1 [P16144-3]
CCDS58599.1 [P16144-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC5545
S12380 A36429

NCBI Reference Sequences

More...
RefSeqi
NP_000204.3, NM_000213.4 [P16144-1]
NP_001005619.1, NM_001005619.1 [P16144-3]
NP_001005731.1, NM_001005731.2 [P16144-2]
NP_001308052.1, NM_001321123.1 [P16144-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.632226

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000200181; ENSP00000200181; ENSG00000132470 [P16144-1]
ENST00000449880; ENSP00000400217; ENSG00000132470 [P16144-3]
ENST00000450894; ENSP00000405536; ENSG00000132470 [P16144-2]
ENST00000579662; ENSP00000463651; ENSG00000132470 [P16144-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3691

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3691

UCSC genome browser

More...
UCSCi
uc002jpg.3 human [P16144-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X51841 mRNA Translation: CAA36134.1
X52186 mRNA Translation: CAA36433.1
X53587 mRNA Translation: CAA37656.1 Frameshift.
U66541
, U66530, U66531, U66532, U66533, U66534, U66535, U66536, U66537, U66538, U66539, U66540 Genomic DNA Translation: AAC51634.1
U66541
, U66530, U66531, U66532, U66533, U66534, U66535, U66536, U66537, U66538, U66539, U66540 Genomic DNA Translation: AAC51633.1
U66541
, U66530, U66531, U66532, U66533, U66534, U66535, U66536, U66537, U66538, U66539, U66540 Genomic DNA Translation: AAC51632.1
AC087749 Genomic DNA No translation available.
CH471099 Genomic DNA Translation: EAW89305.1
BC118916 mRNA Translation: AAI18917.1
BC126411 mRNA Translation: AAI26412.1
AJ251004, Y11107 Genomic DNA Translation: CAB61345.1
AF011375 mRNA Translation: AAB65421.1
AF011376 Genomic DNA Translation: AAB65422.1
CCDSiCCDS11727.1 [P16144-1]
CCDS32736.1 [P16144-3]
CCDS58599.1 [P16144-2]
PIRiJC5545
S12380 A36429
RefSeqiNP_000204.3, NM_000213.4 [P16144-1]
NP_001005619.1, NM_001005619.1 [P16144-3]
NP_001005731.1, NM_001005731.2 [P16144-2]
NP_001308052.1, NM_001321123.1 [P16144-2]
UniGeneiHs.632226

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1QG3X-ray2.15A/B1126-1320[»]
2YRZNMR-A1518-1622[»]
3F7PX-ray2.75C/D/E1126-1369[»]
3F7QX-ray1.75A/B1126-1355[»]
3F7RX-ray2.04A1126-1369[»]
3FQ4X-ray1.49A/B989-1107[»]
3FSOX-ray1.41A/B989-1107[»]
3H6AX-ray1.61A/B989-1107[»]
4Q58X-ray4.00C/D1126-1320[»]
4WTWX-ray1.61A/B1527-1618[»]
4WTXX-ray1.50A1642-1736[»]
ProteinModelPortaliP16144
SMRiP16144
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109897, 36 interactors
ComplexPortaliCPX-1822 Integrin alpha6-beta4 complex
CORUMiP16144
DIPiDIP-40182N
ELMiP16144
IntActiP16144, 87 interactors
MINTiP16144
STRINGi9606.ENSP00000200181

Chemistry databases

DrugBankiDB05122 R1295

PTM databases

GlyConnecti1417
iPTMnetiP16144
PhosphoSitePlusiP16144
SwissPalmiP16144

Polymorphism and mutation databases

BioMutaiITGB4
DMDMi317373584

Proteomic databases

EPDiP16144
MaxQBiP16144
PaxDbiP16144
PeptideAtlasiP16144
PRIDEiP16144
ProteomicsDBi53292
53293 [P16144-2]
53294 [P16144-3]
53295 [P16144-4]
53296 [P16144-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000200181; ENSP00000200181; ENSG00000132470 [P16144-1]
ENST00000449880; ENSP00000400217; ENSG00000132470 [P16144-3]
ENST00000450894; ENSP00000405536; ENSG00000132470 [P16144-2]
ENST00000579662; ENSP00000463651; ENSG00000132470 [P16144-2]
GeneIDi3691
KEGGihsa:3691
UCSCiuc002jpg.3 human [P16144-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3691
DisGeNETi3691
EuPathDBiHostDB:ENSG00000132470.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ITGB4
GeneReviewsiITGB4

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0039036
HGNCiHGNC:6158 ITGB4
HPAiCAB002422
CAB005258
HPA036348
HPA036349
MalaCardsiITGB4
MIMi131800 phenotype
147557 gene
226650 phenotype
226730 phenotype
neXtProtiNX_P16144
OpenTargetsiENSG00000132470
Orphaneti158684 Epidermolysis bullosa simplex with pyloric atresia
79402 Junctional epidermolysis bullosa, generalized intermediate
79403 Junctional epidermolysis bullosa-pyloric atresia syndrome
251393 Localized junctional epidermolysis bullosa, non-Herlitz type
PharmGKBiPA29957

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1226 Eukaryota
ENOG410XP60 LUCA
GeneTreeiENSGT00940000153730
HOGENOMiHOG000231105
HOVERGENiHBG006189
InParanoidiP16144
KOiK06525
OMAiKVKYWIQ
OrthoDBiEOG091G029W
PhylomeDBiP16144
TreeFamiTF105392

Enzyme and pathway databases

ReactomeiR-HSA-2022090 Assembly of collagen fibrils and other multimeric structures
R-HSA-3000157 Laminin interactions
R-HSA-3000170 Syndecan interactions
R-HSA-446107 Type I hemidesmosome assembly
SignaLinkiP16144
SIGNORiP16144

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ITGB4 human
EvolutionaryTraceiP16144

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ITGB4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3691

Protein Ontology

More...
PROi
PR:P16144

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000132470 Expressed in 215 organ(s), highest expression level in tibial nerve
CleanExiHS_ITGB4
ExpressionAtlasiP16144 baseline and differential
GenevisibleiP16144 HS

Family and domain databases

CDDicd00063 FN3, 4 hits
Gene3Di2.60.40.10, 4 hits
2.60.40.2030, 1 hit
3.40.50.410, 1 hit
InterProiView protein in InterPro
IPR038081 CalX-like_sf
IPR003644 Calx_beta
IPR013032 EGF-like_CS
IPR013111 EGF_extracell
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
IPR033760 Integrin_beta_N
IPR015812 Integrin_bsu
IPR012013 Integrin_bsu-4
IPR012896 Integrin_bsu_tail
IPR036349 Integrin_bsu_tail_dom_sf
IPR002369 Integrin_bsu_VWA
IPR016201 PSI
IPR036465 vWFA_dom_sf
PANTHERiPTHR10082 PTHR10082, 1 hit
PTHR10082:SF42 PTHR10082:SF42, 1 hit
PfamiView protein in Pfam
PF03160 Calx-beta, 1 hit
PF07974 EGF_2, 1 hit
PF00041 fn3, 4 hits
PF07965 Integrin_B_tail, 1 hit
PF00362 Integrin_beta, 1 hit
PF17205 PSI_integrin, 1 hit
PIRSFiPIRSF002513 Integrin_B4, 1 hit
PRINTSiPR01186 INTEGRINB
SMARTiView protein in SMART
SM00237 Calx_beta, 1 hit
SM00060 FN3, 4 hits
SM00187 INB, 1 hit
SM01242 Integrin_B_tail, 1 hit
SM00423 PSI, 1 hit
SUPFAMiSSF141072 SSF141072, 1 hit
SSF49265 SSF49265, 2 hits
SSF53300 SSF53300, 1 hit
SSF69687 SSF69687, 1 hit
PROSITEiView protein in PROSITE
PS00022 EGF_1, 2 hits
PS01186 EGF_2, 2 hits
PS50853 FN3, 4 hits
PS00243 INTEGRIN_BETA, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiITB4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P16144
Secondary accession number(s): A0AVL6
, O14690, O14691, O15339, O15340, O15341, Q0VF97, Q9UIQ4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: January 11, 2011
Last modified: December 5, 2018
This is version 231 of the entry and version 5 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  4. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  7. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again