Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P15941 (MUC1_HUMAN)

Entry version 225 (02 Dec 2020)
Sequence version 3 (18 May 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Mucin-1

Gene

MUC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack.
The beta subunit contains a C-terminal domain which is involved in cell signaling, through phosphorylations and protein-protein interactions. Modulates signaling in ERK, SRC and NF-kappa-B pathways. In activated T-cells, influences directly or indirectly the Ras/MAPK pathway. Promotes tumor progression. Regulates TP53-mediated transcription and determines cell fate in the genotoxic stress response. Binds, together with KLF4, the PE21 promoter element of TP53 and represses TP53 activity.

Miscellaneous

The name KL-6 was originally that of a murine monoclonal antibody reacting with pulmonary adenocarcinoma cell lines and pulmonary epithelial cells. This antibody recognizes a sialylated carbohydrate chain on MUC1.

Caution

O-glycosylation sites are annotated in first sequence repeat only. Residues at similar position are probably glycosylated in all repeats. Experimental sites were determined in a synthetic peptide glycosylated in vitro (PubMed:7744025, PubMed:9597769).2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P15941

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5083625, Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
R-HSA-5083632, Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)
R-HSA-5083636, Defective GALNT12 causes colorectal cancer 1 (CRCS1)
R-HSA-5621480, Dectin-2 family
R-HSA-6785807, Interleukin-4 and Interleukin-13 signaling
R-HSA-913709, O-linked glycosylation of mucins
R-HSA-977068, Termination of O-glycan biosynthesis

SIGNOR Signaling Network Open Resource

More...SIGNORi		P15941

Protein family/group databases

MEROPS protease database

More...MEROPSi		S71.001

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mucin-1
Short name:
MUC-1
Alternative name(s):
Breast carcinoma-associated antigen DF3
Cancer antigen 15-3
Short name:
CA 15-3
Carcinoma-associated mucin
Episialin
H23AG
Krebs von den Lungen-6
Short name:
KL-6
PEMT
Peanut-reactive urinary mucin
Short name:
PUM
Polymorphic epithelial mucin
Short name:
PEM
Tumor-associated epithelial membrane antigen
Short name:
EMA
Tumor-associated mucin
CD_antigen: CD227
Cleaved into the following 2 chains:
Mucin-1 subunit alpha
Short name:
MUC1-NT
Short name:
MUC1-alpha
Mucin-1 subunit beta
Short name:
MUC1-beta
Alternative name(s):
MUC1-CT
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MUC1
Synonyms:PUM
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000185499.16

Human Gene Nomenclature Database

More...HGNCi		HGNC:7508, MUC1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		113720, gene
158340, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P15941

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini24 – 1158ExtracellularSequence analysisAdd BLAST1135
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1159 – 1181HelicalSequence analysisAdd BLAST23
Topological domaini1182 – 1255CytoplasmicSequence analysisAdd BLAST74

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

MUC1/CA 15-3 is used as a serological clinical marker of breast cancer to monitor response to breast cancer treatment and disease recurrence (PubMed:20816948). Decreased levels over time may be indicative of a positive response to treatment. Conversely, increased levels may indicate disease progression. At an early stage disease, only 21% of patients exhibit high MUC1/CA 15-3 levels, that is why CA 15-3 is not a useful screening test. Most antibodies target the highly immunodominant core peptide domain of 20 amino acid (APDTRPAPGSTAPPAHGVTS) tandem repeats. Some antibodies recognize glycosylated epitopes.1 Publication
Medullary cystic kidney disease 1 (MCKD1)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of tubulointerstitial nephropathy characterized by formation of renal cysts at the corticomedullary junction. It is characterized by adult onset of impaired renal function and salt wasting resulting in end-stage renal failure by the sixth decade.
Related information in OMIM

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1098S → A, D, E, F, G, H, I, K, L, M, N, P, Q, R, V, W or Y: Completely abrogates cleavage. 1 Publication1
Mutagenesisi1098S → C or T: Almost complete cleavage. 1 Publication1
Mutagenesisi1116D → A: Greatly reduced formation of isoform 5/isoform Y complex. 1 Publication1
Mutagenesisi1116D → E: No effect on formation of isoform 5/isoform Y complex. 1 Publication1
Mutagenesisi1184C → A: S-palmitoylation reduced by 50%. Complete loss of palmitoylation, no effect on endocytosis, recycling inhibited and AP1S1 binding reduced by 30%; when associated with C-1186. Accumulates in intracellular compartments; when associated with C-1186 and N-1203. 1 Publication1
Mutagenesisi1186C → A: S-palmitoylation reduced by 50%. Complete loss of palmitoylation, no effect on endocytosis, recycling inhibited, and AP1S1 binding reduced by 30%; when associated with C-1184. Accumulates in intracellular compartments; when associated with C-1184 and N-1203. 1 Publication1
Mutagenesisi1187 – 1189RRK → AAA: No nuclear targeting of HRG-stimulated MUC1 C-terminal nor JUP/gamma-catenin. No effect on interaction with JUP/gamma-catenin. 2 Publications3
Mutagenesisi1187 – 1189RRK → QQQ: No effect on palmitoylation. 2 Publications3
Mutagenesisi1191Y → F: No effect on EGFR-mediated phosphorylation. 2 Publications1
Mutagenesisi1191Y → N: No effect on endocytosis. 2 Publications1
Mutagenesisi1203Y → E: No effect on nuclear colocalization of MUC1CT and CTNNB1. No effect on in vitro PDFGR-induced cell invasiveness. 4 Publications1
Mutagenesisi1203Y → F: No effect on EGFR-mediated phosphorylation. No nuclear localization of MUC1CT. Reduced in vitro PDGFR-induced cell invasiveness. 4 Publications1
Mutagenesisi1203Y → N: Reduced endocytosis by 30%. Greatly reduced binding to AP1S2 and GRB2. Binding AP1S1 reduced by 25%. Reduced endocytosis by 77%; when associated with N-1243. Accumulates in intracellular compartments; when associated with C-1184 and C-1186. 4 Publications1
Mutagenesisi1209Y → F: Some reduction in EGFR-mediated phosphorylation. 1 Publication1
Mutagenesisi1218Y → F: No effect on EGFR-mediated phosphorylation. No nuclear colocalization of MUC1CT and CTNNB1. 2 Publications1
Mutagenesisi1223S → A: No change in PRKCD- nor GSK3B-mediated phosphorylation. 2 Publications1
Mutagenesisi1224T → A: Loss of PRKCD-mediated phosphorylation. Decreased PRKCD binding. No increased binding to CTNNB1 in the presence of autophosphorylated PRKCD. Increases formation of E-cadherin/beta-catenin complex. 1 Publication1
Mutagenesisi1227S → A: No change in PRKCD-mediated phosphorylation. Loss of GSK3B-mediated phosphorylation. CTNNB1. 2 Publications1
Mutagenesisi1229Y → F: Greatly reduced EGFR- and Src-mediated phosphorylation. No nuclear localization of MUC1CT. Reduced in vitro PDGFR-mediated phosphorylation. Decreased Src-binding. 4 Publications1
Mutagenesisi1229Y → N: No effect on endocytosis. 4 Publications1
Mutagenesisi1243Y → N: Reduces binding to AP1S2 by 33%. Greatly reduced binding to GRB2. Reduced endocytosis by 50%. Reduced endocytosis by 77%; when associated with N-1203. 1 Publication1

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

DisGeNET

More...DisGeNETi		4582

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...GeneReviewsi		MUC1

MalaCards human disease database

More...MalaCardsi		MUC1
MIMi174000, phenotype

Open Targets

More...OpenTargetsi		ENSG00000185499

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		88949, MUC1-related autosomal dominant tubulointerstitial kidney disease

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA31309

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P15941, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3580494

Drug and drug target database

More...DrugBanki		DB11090, Potassium nitrate
DB06584, TG4010

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		MUC1

Domain mapping of disease mutations (DMDM)

More...DMDMi		296439295

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 232 PublicationsAdd BLAST23
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001927724 – 1255Mucin-1Add BLAST1232
ChainiPRO_000031744624 – 1097Mucin-1 subunit alphaAdd BLAST1074
ChainiPRO_00003174471098 – 1255Mucin-1 subunit betaAdd BLAST158

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi131O-linked (GalNAc...) threonine2 Publications1
Glycosylationi139O-linked (GalNAc...) threonine2 Publications1
Glycosylationi140O-linked (GalNAc...) serineSequence analysis1
Glycosylationi144O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi957N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi975N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1029N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1055N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1133N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi1184S-palmitoyl cysteine1 Publication1
Lipidationi1186S-palmitoyl cysteine1 Publication1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1203Phosphotyrosine; by PDGFR2 Publications1
Modified residuei1212Phosphotyrosine1 Publication1
Modified residuei1218Phosphotyrosine; by PDGFR1 Publication1
Modified residuei1224Phosphothreonine; by PKC/PRKCD1 Publication1
Modified residuei1227Phosphoserine; by GSK3-betaCombined sources1 Publication1
Modified residuei1229Phosphotyrosine; by CSK, EGFR and SRC4 Publications1
Modified residuei1243Phosphotyrosine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Highly glycosylated (N- and O-linked carbohydrates and sialic acid). O-glycosylated to a varying degree on serine and threonine residues within each tandem repeat, ranging from mono- to penta-glycosylation. The average density ranges from about 50% in human milk to over 90% in T47D breast cancer cells. Further sialylation occurs during recycling. Membrane-shed glycoproteins from kidney and breast cancer cells have preferentially sialyated core 1 structures, while secreted forms from the same tissues display mainly core 2 structures. The O-glycosylated content is overlapping in both these tissues with terminal fucose and galactose, 2- and 3-linked galactose, 3- and 3,6-linked GalNAc-ol and 4-linked GlcNAc predominating. Differentially O-glycosylated in breast carcinomas with 3,4-linked GlcNAc. N-glycosylation consists of high-mannose, acidic complex-type and hybrid glycans in the secreted form MUC1/SEC, and neutral complex-type in the transmembrane form, MUC1/TM.4 Publications
Proteolytic cleavage in the SEA domain occurs in the endoplasmic reticulum by an autoproteolytic mechanism and requires the full-length SEA domain as well as requiring a Ser, Thr or Cys residue at the P + 1 site. Cleavage at this site also occurs on isoform MUC1/X but not on isoform MUC1/Y. Ectodomain shedding is mediated by ADAM17.3 Publications
Dual palmitoylation on cysteine residues in the CQC motif is required for recycling from endosomes back to the plasma membrane.1 Publication
Phosphorylated on tyrosines and serine residues in the C-terminal. Phosphorylation on tyrosines in the C-terminal increases the nuclear location of MUC1 and beta-catenin. Phosphorylation by PKC delta induces binding of MUC1 to beta-catenin/CTNNB1 and thus decreases the formation of the beta-catenin/E-cadherin complex. Src-mediated phosphorylation inhibits interaction with GSK3B. Src- and EGFR-mediated phosphorylation on Tyr-1229 increases binding to beta-catenin/CTNNB1. GSK3B-mediated phosphorylation on Ser-1227 decreases this interaction but restores the formation of the beta-cadherin/E-cadherin complex. On T-cell receptor activation, phosphorylated by LCK. PDGFR-mediated phosphorylation increases nuclear colocalization of MUC1CT and CTNNB1.11 Publications
The N-terminal sequence has been shown to begin at position 24 or 28.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei1097 – 1098Cleavage; by autolysis2

Keywords - PTMi

Autocatalytic cleavage, Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...CPTACi		CPTAC-146
CPTAC-147
CPTAC-719
CPTAC-730

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P15941

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P15941

MaxQB - The MaxQuant DataBase

More...MaxQBi		P15941

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P15941

PeptideAtlas

More...PeptideAtlasi		P15941

PRoteomics IDEntifications database

More...PRIDEi		P15941

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		1779
53249 [P15941-1]
53250 [P15941-10]
53251 [P15941-2]
53252 [P15941-3]
53253 [P15941-4]
53254 [P15941-5]
53255 [P15941-6]
53256 [P15941-7]
53257 [P15941-8]
53258 [P15941-9]
58806
6245
69255
69256
767

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		372, 9 O-Linked glycans
373, 8 O-Linked glycans
374, 8 O-Linked glycans
375, 10 O-Linked glycans
376, 10 O-Linked glycans
377, 7 O-Linked glycans
413, 5 N-Linked glycans (1 site), 14 O-Linked glycans

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P15941, 13 sites, 5 O-linked glycans (4 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P15941

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P15941

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P15941

UniCarbKB; an annotated and curated database of glycan structures

More...UniCarbKBi		P15941

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed on the apical surface of epithelial cells, especially of airway passages, breast and uterus. Also expressed in activated and unactivated T-cells. Overexpressed in epithelial tumors, such as breast or ovarian cancer and also in non-epithelial tumor cells. Isoform Y is expressed in tumor cells only.2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

During fetal development, expressed at low levels in the colonic epithelium from 13 weeks of gestation.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000185499, Expressed in body of stomach and 212 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P15941, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P15941, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000185499, Tissue enhanced (gallbladder, kidney, lung)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The alpha subunit forms a tight, non-covalent heterodimeric complex with the proteolytically-released beta-subunit. Interaction, via the tandem repeat region, with domain 1 of ICAM1 is implicated in cell migration and metastases. Isoform 1 binds directly the SH2 domain of GRB2, and forms a MUC1/GRB2/SOS1 complex involved in RAS signaling. The cytoplasmic tail (MUC1CT) interacts with several proteins such as SRC, CTNNB1 and ERBs. Interaction with the SH2 domain of CSK decreases interaction with GSK3B.

Interacts with CTNNB1/beta-catenin and JUP/gamma-catenin and promotes cell adhesion. Interaction with JUP/gamma-catenin is induced by heregulin. Binds PRKCD, ERBB2, ERBB3 and ERBB4. Heregulin (HRG) stimulates the interaction with ERBB2 and, to a much lesser extent, the interaction with ERBB3 and ERBB4.

Interacts with P53 in response to DNA damage.

Interacts with KLF4.

Interacts with estrogen receptor alpha/ESR1, through its DNA-binding domain, and stimulates its transcription activity. Binds ADAM17. Isoform ZD forms disulfide-linked oligomers.

21 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

P15941
With#Exp.IntAct
ABL1 [P00519]8EBI-2804728,EBI-375543
EGFR [P00533]4EBI-2804728,EBI-297353
MET [P08581]2EBI-2804728,EBI-1039152
MUC1 - isoform Y [P15941-7]2EBI-2804728,EBI-4396776
U2AF2 [P26368]2EBI-2804728,EBI-742339
Isoform Y-LSP [P15941-11]
With#Exp.IntAct
ADAM33 [Q08AM2]3EBI-17263240,EBI-10225815
ADGRB3 [O60242]3EBI-17263240,EBI-2682765
ADIPOQ [Q15848]3EBI-17263240,EBI-10827839
ANKRD46 - isoform 1 [Q86W74-2]3EBI-17263240,EBI-12109402
APOA2 [P02652]3EBI-17263240,EBI-1171525
APP - isoform APP305 [P05067-2]3EBI-17263240,EBI-17264467
AQP1 [P29972]3EBI-17263240,EBI-745213
AQP2 [P41181]3EBI-17263240,EBI-12701138
AQP3 [Q92482]3EBI-17263240,EBI-2808854
ARV1 [Q9H2C2]3EBI-17263240,EBI-11724186
BCL2L2 [Q92843]3EBI-17263240,EBI-707714
BRICD5 - isoform 2 [Q6PL45-2]3EBI-17263240,EBI-12244618
BTN2A2 [Q8WVV5]3EBI-17263240,EBI-8648738
C2 [P06681]3EBI-17263240,EBI-2835920
C2CD2L [O14523]3EBI-17263240,EBI-12822627
CACNG1 [Q06432]3EBI-17263240,EBI-9686780
CCDC167 [Q9P0B6]3EBI-17263240,EBI-9083477
CD47 - isoform OA3-305 [Q08722-3]3EBI-17263240,EBI-17263290
CD53 [P19397]3EBI-17263240,EBI-6657396
CD68 [P34810]3EBI-17263240,EBI-2826276
CLDN19 - isoform 2 [Q8N6F1-2]3EBI-17263240,EBI-12256978
CLDN6 [P56747]3EBI-17263240,EBI-12955011
CLDND2 [Q8NHS1]3EBI-17263240,EBI-11959453
CMTM7 [Q96FZ5]3EBI-17263240,EBI-2807956
COL8A2 [Q4VAQ0]3EBI-17263240,EBI-10241815
CSGALNACT2 [Q8N6G5]3EBI-17263240,EBI-10267100
CXCL9 [Q07325]3EBI-17263240,EBI-3911467
CYB5B [O43169]3EBI-17263240,EBI-1058710
CYP4F2 [P78329]3EBI-17263240,EBI-1752413
EDDM3B [P56851]3EBI-17263240,EBI-10215665
EMC6 [Q9BV81]3EBI-17263240,EBI-2820492
EMP3 [P54852]3EBI-17263240,EBI-3907816
ENTPD3 - isoform 2 [O75355-2]3EBI-17263240,EBI-12279764
ERG28 [Q9UKR5]3EBI-17263240,EBI-711490
GAST [P01350]3EBI-17263240,EBI-3436637
GDNF - isoform 3 [P39905-3]3EBI-17263240,EBI-12702062
GOLT1B [Q9Y3E0]3EBI-17263240,EBI-4402607
GPR108 [Q9NPR9]3EBI-17263240,EBI-11343451
HHATL [Q9HCP6]3EBI-17263240,EBI-5916693
ICMT [O60725]3EBI-17263240,EBI-11721771
INSIG2 [Q9Y5U4]3EBI-17263240,EBI-8503746
ITGAM [P11215]3EBI-17263240,EBI-2568251
MAL2 [Q969L2]3EBI-17263240,EBI-944295
MALL [Q13021]3EBI-17263240,EBI-750078
MARCHF2 [Q9P0N8]3EBI-17263240,EBI-10317612
MFSD5 [Q6N075]3EBI-17263240,EBI-3920969
MIP [P30301]3EBI-17263240,EBI-8449636
MYADM [Q96S97]3EBI-17263240,EBI-13301517
NDUFA3 [O95167]3EBI-17263240,EBI-1246131
NEU1 [Q99519]3EBI-17263240,EBI-721517
NINJ1 [Q92982]3EBI-17263240,EBI-2802124
NINJ2 [Q9NZG7]3EBI-17263240,EBI-10317425
NKG7 [Q16617]3EBI-17263240,EBI-3919611
NRAC [Q8N912]3EBI-17263240,EBI-12051377
OR10AG1 [Q8NH19]3EBI-17263240,EBI-13339917
PAQR6 [Q6TCH4]3EBI-17263240,EBI-17265310
PLN [P26678]3EBI-17263240,EBI-692836
PLP1 - isoform DM-20 [P60201-2]3EBI-17263240,EBI-12188331
PLPP6 [Q8IY26]3EBI-17263240,EBI-11721828
PNLIPRP1 [P54315]3EBI-17263240,EBI-8652812
PPGB [Q59EV6]3EBI-17263240,EBI-14210385
PPIF [P30405]3EBI-17263240,EBI-5544229
RFT1 [Q96AA3]3EBI-17263240,EBI-6269616
RHD - isoform 2 [Q02161-2]3EBI-17263240,EBI-17249212
SCAMP5 [Q8TAC9]3EBI-17263240,EBI-2695784
SELENOK [Q9Y6D0]3EBI-17263240,EBI-9679163
SERP2 [Q8N6R1]3EBI-17263240,EBI-749270
SFTPC [P11686]3EBI-17263240,EBI-10197617
SLC30A8 [Q8IWU4]3EBI-17263240,EBI-10262251
SLC35B4 [Q969S0]3EBI-17263240,EBI-10281213
SLC35E4 [Q6ICL7]3EBI-17263240,EBI-12867720
SLC38A7 [Q9NVC3]3EBI-17263240,EBI-10314552
SMCO4 [Q9NRQ5]3EBI-17263240,EBI-8640191
SMIM1 [B2RUZ4]3EBI-17263240,EBI-12188413
TECR [Q9NZ01]3EBI-17263240,EBI-2877718
THBD [P07204]3EBI-17263240,EBI-941422
TM6SF2 [Q9BZW4]3EBI-17263240,EBI-13082040
TMEM11 [P17152]3EBI-17263240,EBI-723946
TMEM120B [A0PK00]3EBI-17263240,EBI-10171534
TMEM121 [Q9BTD3]3EBI-17263240,EBI-12155101
TMEM128 - isoform 2 [Q5BJH2-2]3EBI-17263240,EBI-10694905
TMEM147 [Q9BVK8]3EBI-17263240,EBI-348587
TMEM14A [Q9Y6G1]3EBI-17263240,EBI-2800360
TMEM14C [Q9P0S9]3EBI-17263240,EBI-2339195
TMEM187 [Q14656]3EBI-17263240,EBI-13046724
TMEM229B [Q8NBD8]3EBI-17263240,EBI-12195227
TMEM243 [Q9BU79]3EBI-17263240,EBI-12887458
TMEM86A [Q8N2M4]3EBI-17263240,EBI-12015604
TMEM86B [Q8N661]3EBI-17263240,EBI-2548832
TMEM97 [Q5BJF2]3EBI-17263240,EBI-12111910
TMEM98 [Q9Y2Y6]3EBI-17263240,EBI-7333781
TNFRSF10B [O14763]3EBI-17263240,EBI-518882
TRAM1L1 [Q8N609]3EBI-17263240,EBI-11996766
TTMP [Q5BVD1]3EBI-17263240,EBI-10243654
UNC50 [Q53HI1]3EBI-17263240,EBI-7601760
VAMP5 [O95183]3EBI-17263240,EBI-10191195
VKORC1 [Q9BQB6]3EBI-17263240,EBI-6256462
ZDHHC21 [Q8IVQ6]3EBI-17263240,EBI-2849773
Mucin-1 subunit beta (PRO_0000317447)
With#Exp.IntAct
CEBPB [P17676]8EBI-10053698,EBI-969696

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		110669, 147 interactors

Database of interacting proteins

More...DIPi		DIP-41890N

Protein interaction database and analysis system

More...IntActi		P15941, 121 interactors

Molecular INTeraction database

More...MINTi		P15941

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000484824

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P15941, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11255
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P15941

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P15941

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati61 – 801; approximate1 PublicationAdd BLAST20
Repeati81 – 1002; approximate1 PublicationAdd BLAST20
Repeati101 – 12031 PublicationAdd BLAST20
Repeati121 – 14041 PublicationAdd BLAST20
Repeati141 – 16051 PublicationAdd BLAST20
Repeati161 – 18061 PublicationAdd BLAST20
Repeati181 – 20071 PublicationAdd BLAST20
Repeati201 – 22081 PublicationAdd BLAST20
Repeati221 – 24091 PublicationAdd BLAST20
Repeati241 – 260101 PublicationAdd BLAST20
Repeati261 – 280111 PublicationAdd BLAST20
Repeati281 – 300121 PublicationAdd BLAST20
Repeati301 – 320131 PublicationAdd BLAST20
Repeati321 – 340141 PublicationAdd BLAST20
Repeati341 – 360151 PublicationAdd BLAST20
Repeati361 – 380161 PublicationAdd BLAST20
Repeati381 – 400171 PublicationAdd BLAST20
Repeati401 – 420181 PublicationAdd BLAST20
Repeati421 – 440191 PublicationAdd BLAST20
Repeati441 – 460201 PublicationAdd BLAST20
Repeati461 – 480211 PublicationAdd BLAST20
Repeati481 – 500221 PublicationAdd BLAST20
Repeati501 – 520231 PublicationAdd BLAST20
Repeati521 – 540241 PublicationAdd BLAST20
Repeati541 – 560251 PublicationAdd BLAST20
Repeati561 – 580261 PublicationAdd BLAST20
Repeati581 – 600271 PublicationAdd BLAST20
Repeati601 – 620281 PublicationAdd BLAST20
Repeati621 – 640291 PublicationAdd BLAST20
Repeati641 – 660301 PublicationAdd BLAST20
Repeati661 – 680311 PublicationAdd BLAST20
Repeati681 – 700321 PublicationAdd BLAST20
Repeati701 – 720331 PublicationAdd BLAST20
Repeati721 – 740341 PublicationAdd BLAST20
Repeati741 – 760351 PublicationAdd BLAST20
Repeati761 – 780361 PublicationAdd BLAST20
Repeati781 – 800371 PublicationAdd BLAST20
Repeati801 – 820381 PublicationAdd BLAST20
Repeati821 – 840391 PublicationAdd BLAST20
Repeati841 – 860401 PublicationAdd BLAST20
Repeati861 – 880411 PublicationAdd BLAST20
Repeati881 – 900421 PublicationAdd BLAST20
Repeati901 – 920431 PublicationAdd BLAST20
Repeati921 – 940441 PublicationAdd BLAST20
Repeati941 – 960451 PublicationAdd BLAST20
Repeati961 – 98046; approximate1 PublicationAdd BLAST20
Repeati981 – 100047; approximate1 PublicationAdd BLAST20
Repeati1001 – 102048; approximate1 PublicationAdd BLAST20
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1039 – 1148SEAPROSITE-ProRule annotationAdd BLAST110

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni126 – 96542 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-RAdd BLAST840
Regioni1192 – 1228Interaction with P53Add BLAST37
Regioni1223 – 1230Required for interaction with GSK3B8
Regioni1233 – 1241Required for interaction with beta- and gamma-catenins9

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1203 – 1206Interaction with GRB24
Motifi1229 – 1232Interaction with SRC and ESR14
Motifi1243 – 1246Required for interaction with AP1S24

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QWCT, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00710000106874

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_1386987_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P15941

Database of Orthologous Groups

More...OrthoDBi		945460at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P15941

Family and domain databases

Database of protein disorder

More...DisProti		DP01790

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.70.960, 1 hit

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00195

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR023217, Mucin-1
IPR000082, SEA_dom
IPR036364, SEA_dom_sf

The PANTHER Classification System

More...PANTHERi		PTHR10006, PTHR10006, 7 hits

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01390, SEA, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00200, SEA, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF82671, SSF82671, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50024, SEA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (17+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 17 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 17 described isoforms and 17 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P15941-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTPGTQSPFF LLLLLTVLTV VTGSGHASST PGGEKETSAT QRSSVPSSTE 
        60         70         80         90        100
KNAVSMTSSV LSSHSPGSGS STTQGQDVTL APATEPASGS AATWGQDVTS 
       110        120        130        140        150
VPVTRPALGS TTPPAHDVTS APDNKPAPGS TAPPAHGVTS APDTRPAPGS 
       160        170        180        190        200
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS 
       210        220        230        240        250
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS 
       260        270        280        290        300
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS 
       310        320        330        340        350
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS 
       360        370        380        390        400
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS 
       410        420        430        440        450
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS 
       460        470        480        490        500
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS 
       510        520        530        540        550
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS 
       560        570        580        590        600
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS 
       610        620        630        640        650
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS 
       660        670        680        690        700
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS 
       710        720        730        740        750
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS 
       760        770        780        790        800
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS 
       810        820        830        840        850
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS 
       860        870        880        890        900
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS 
       910        920        930        940        950
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDNRPALGS 
       960        970        980        990       1000
TAPPVHNVTS ASGSASGSAS TLVHNGTSAR ATTTPASKST PFSIPSHHSD 
      1010       1020       1030       1040       1050
TPTTLASHST KTDASSTHHS SVPPLTSSNH STSPQLSTGV SFFFLSFHIS 
      1060       1070       1080       1090       1100
NLQFNSSLED PSTDYYQELQ RDISEMFLQI YKQGGFLGLS NIKFRPGSVV 
      1110       1120       1130       1140       1150
VQLTLAFREG TINVHDVETQ FNQYKTEAAS RYNLTISDVS VSDVPFPFSA 
      1160       1170       1180       1190       1200
QSGAGVPGWG IALLVLVCVL VALAIVYLIA LAVCQCRRKN YGQLDIFPAR 
      1210       1220       1230       1240       1250
DTYHPMSEYP TYHTHGRYVP PSSTDRSPYE KVSAGNGGSS LSYTNPAVAA 

TSANL
Length:1,255
Mass (Da):122,102
Last modified:May 18, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5E28DFC4C20D9A82
GO
Isoform 2 (identifier: P15941-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT

Show »
Length:1,264
Mass (Da):122,941
Checksum:i3810149471D221FD
GO
Isoform 3 (identifier: P15941-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     19-21: Missing.

Show »
Length:1,252
Mass (Da):121,803
Checksum:iA3F30DBFE56DD0C5
GO
Isoform 4 (identifier: P15941-4) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     20-31: Missing.

Show »
Length:1,243
Mass (Da):121,021
Checksum:iB2C6288C94AABC14
GO
Isoform 5 (identifier: P15941-5) [UniParc]FASTAAdd to basket
Also known as: SEC

The sequence of this isoform differs from the canonical sequence as follows:
     1077-1087: FLQIYKQGGFL → VSIGLSFPMLP
     1088-1255: Missing.

Show »
Length:1,087
Mass (Da):103,836
Checksum:i6039CBB69974EA3E
GO
Isoform 6 (identifier: P15941-6) [UniParc]FASTAAdd to basket
Also known as: X

The sequence of this isoform differs from the canonical sequence as follows:
     54-70: VSMTSSVLSSHSPGSGS → IPAPTTTKSCRETFLKW
     71-1095: Missing.

Show »
Length:230
Mass (Da):24,566
Checksum:i53B036250EC1242D
GO
Isoform Y (identifier: P15941-7) [UniParc]FASTAAdd to basket
Also known as: MUC1/Y

The sequence of this isoform differs from the canonical sequence as follows:
     54-1053: Missing.

Show »
Length:255
Mass (Da):27,566
Checksum:i46DC2580CF357BEF
GO
Isoform 8 (identifier: P15941-8) [UniParc]FASTAAdd to basket
Also known as: Z

The sequence of this isoform differs from the canonical sequence as follows:
     54-1035: Missing.

Show »
Length:273
Mass (Da):29,592
Checksum:iB72F7F4FC2D23BCC
GO
Isoform 9 (identifier: P15941-9) [UniParc]FASTAAdd to basket
Also known as: S

The sequence of this isoform differs from the canonical sequence as follows:
     54-1035: Missing.
     1077-1181: Missing.

Show »
Length:168
Mass (Da):18,277
Checksum:i53C6544C2B077B89
GO
Isoform F (identifier: P15941-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     54-87: VSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPA → IPAPTTTKSCRETFLKCFCRFINKGVFWASPILS
     88-1139: Missing.

Show »
Length:203
Mass (Da):21,556
Checksum:iCC2BE70F8C1B325E
GO
Isoform Y-LSP (identifier: P15941-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT
     54-1053: Missing.

Note: Lacks the mucin repeats.Curated
Show »
Length:264
Mass (Da):28,405
Checksum:i6E192550756A6D4A
GO
Isoform S2 (identifier: P15941-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT
     54-1053: Missing.
     1077-1181: Missing.

Show »
Length:159
Mass (Da):17,090
Checksum:i2C3B69F515D73168
GO
Isoform M6 (identifier: P15941-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     54-1035: Missing.
     1141-1180: VSDVPFPFSA...VALAIVYLIA → GCLSVPPKEL...LPHPWALCAP
     1181-1255: Missing.

Show »
Length:198
Mass (Da):21,663
Checksum:i5300166458B017CB
GO
Isoform ZD (identifier: P15941-14) [UniParc]FASTAAdd to basket
Also known as: J19

The sequence of this isoform differs from the canonical sequence as follows:
     54-96: VSMTSSVLSS...ASGSAATWGQ → IPAPTTTKSC...SSGQDLWWYN
     97-1255: Missing.

Note: Lacks the mucin repeats. Exists as a disulfide-linked oligomer.Curated
Show »
Length:96
Mass (Da):10,403
Checksum:iF2140812C4C11983
GO
Isoform T10 (identifier: P15941-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT
     54-1093: Missing.

Show »
Length:224
Mass (Da):23,747
Checksum:i977E7703C14AC936
GO
Isoform E2 (identifier: P15941-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT
     54-1151: Missing.

Show »
Length:166
Mass (Da):17,287
Checksum:iBF6C969984986AD0
GO
Isoform J13 (identifier: P15941-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT
     54-1053: Missing.
     1232-1255: VSAGNGGSSLSYTNPAVAATSANL → RQNGWSTMPRGALPEESQG

Show »
Length:259
Mass (Da):28,297
Checksum:iFD53C9223E24B094
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 17 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X2A4A0A087X2A4_HUMAN
MUC1-CT
MUC1
484Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGW3A0A0C4DGW3_HUMAN
MUC1-CT
MUC1
475Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MRB3A0A0A0MRB3_HUMAN
MUC1-CT
MUC1
241Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WWM1A0A087WWM1_HUMAN
MUC1-CT
MUC1
1,262Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AVQ7B1AVQ7_HUMAN
MUC1-CT
MUC1
229Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSH4A0A0A0MSH4_HUMAN
MUC1-CT
MUC1
268Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WVJ0A0A087WVJ0_HUMAN
MUC1-CT
MUC1
228Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WZZ6A0A087WZZ6_HUMAN
MUC1-CT
MUC1
123Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X061A0A087X061_HUMAN
MUC1-CT
MUC1
96Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A6ZIE4A6ZIE4_HUMAN
MUC1 isoform M10
MUC1
189Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD14369 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAD14376 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti2T → A in AAD14369 (PubMed:8604237).Curated1
Sequence conflicti134P → Q in AAA35757 (PubMed:2597151).Curated1
Sequence conflicti154P → Q in AAA35757 (PubMed:2597151).Curated1
Sequence conflicti1021S → T in AAA35805 (PubMed:2318825).Curated1
Sequence conflicti1021S → T in AAA35807 (PubMed:2318825).Curated1
Sequence conflicti1021S → T in AAA59876 (PubMed:1697589).Curated1
Sequence conflicti1143D → G in AAP97018 (PubMed:22941036).Curated1
Sequence conflicti1193Q → L in AAK30142 (PubMed:15969018).Curated1
Sequence conflicti1231K → T in AAD10858 (PubMed:9212228).Curated1
Sequence conflicti1251T → A in AAA60019 (PubMed:2394722).Curated1

<p>This subsection of the 'Sequence' section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement%5Fin%5Fdisease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

The number of repeats is highly polymorphic. It varies from 21 to 125 in the northern European population. The most frequent alleles contains 41 and 85 repeats. The tandemly repeated icosapeptide underlies polymorphism at three positions: PAPGSTAP[PAQT]AHGVTSAP[DT/ES]R, DT -> ES and the single replacements P -> A, P -> Q and P-> T. The most frequent replacement DT -> ES occurs in up to 50% of the repeats.

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0193901117V → M3 PublicationsCorresponds to variant dbSNP:rs1611770Ensembl.1
Natural variantiVAR_0193911142S → N1 PublicationCorresponds to variant dbSNP:rs11465207Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00328119 – 21Missing in isoform 3. 1 Publication3
Alternative sequenceiVSP_00328019T → TATTAPKPAT in isoform 2, isoform Y-LSP, isoform E2, isoform J13, isoform S2 and isoform T10. 6 Publications1
Alternative sequenceiVSP_00328220 – 31Missing in isoform 4. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_04787254 – 1151Missing in isoform E2. 1 PublicationAdd BLAST1098
Alternative sequenceiVSP_04787354 – 1093Missing in isoform T10. 1 PublicationAdd BLAST1040
Alternative sequenceiVSP_00328554 – 1053Missing in isoform J13, isoform Y, isoform Y-LSP and isoform S2. 6 PublicationsAdd BLAST1000
Alternative sequenceiVSP_00328654 – 1035Missing in isoform 8, isoform 9 and isoform M6. 4 PublicationsAdd BLAST982
Alternative sequenceiVSP_04757554 – 96VSMTS…ATWGQ → IPAPTTTKSCRETFLKCFCR FINKGVFWASPILSSGQDLW WYN in isoform ZD. 2 PublicationsAdd BLAST43
Alternative sequenceiVSP_03504654 – 87VSMTS…ATEPA → IPAPTTTKSCRETFLKCFCR FINKGVFWASPILS in isoform F. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_00328354 – 70VSMTS…PGSGS → IPAPTTTKSCRETFLKW in isoform 6. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_00328471 – 1095Missing in isoform 6. 2 PublicationsAdd BLAST1025
Alternative sequenceiVSP_03504788 – 1139Missing in isoform F. 1 PublicationAdd BLAST1052
Alternative sequenceiVSP_04757697 – 1255Missing in isoform ZD. 2 PublicationsAdd BLAST1159
Alternative sequenceiVSP_0032871077 – 1181Missing in isoform 9 and isoform S2. 3 PublicationsAdd BLAST105
Alternative sequenceiVSP_0032881077 – 1087FLQIYKQGGFL → VSIGLSFPMLP in isoform 5. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_0032891088 – 1255Missing in isoform 5. 1 PublicationAdd BLAST168
Alternative sequenceiVSP_0469621141 – 1180VSDVP…VYLIA → GCLSVPPKELRAAGHLSSPG YLPSYERVPHLPHPWALCAP in isoform M6. 2 PublicationsAdd BLAST40
Alternative sequenceiVSP_0469631181 – 1255Missing in isoform M6. 2 PublicationsAdd BLAST75
Alternative sequenceiVSP_0478741232 – 1255VSAGN…TSANL → RQNGWSTMPRGALPEESQG in isoform J13. 1 PublicationAdd BLAST24

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
J05582 mRNA Translation: AAA60019.1
M32738 mRNA Translation: AAA35804.1
M32739 mRNA Translation: AAA35806.1
M34089 mRNA Translation: AAA35807.1
M34088 mRNA Translation: AAA35805.1
J05581 mRNA Translation: AAA59876.1
M61170 Genomic DNA Translation: AAB53150.1
X52229 mRNA Translation: CAA36478.1 Sequence problems.
X52228 mRNA Translation: CAA36477.1 Sequence problems.
M35093 Genomic DNA Translation: AAB59612.1 Sequence problems.
X80761 mRNA Translation: CAA56734.1
U60259 mRNA Translation: AAD10856.1
U60260 mRNA Translation: AAD10857.1
U60261 mRNA Translation: AAD10858.1
AF125525 mRNA Translation: AAD27842.1
AY466157 mRNA Translation: AAR28764.1
AY327582 mRNA Translation: AAP97013.1
AY327584 mRNA Translation: AAP97015.1
AY327586 mRNA Translation: AAP97017.1
AY327587 mRNA Translation: AAP97018.1
EF583653 mRNA Translation: ABQ59628.1
EF670711 mRNA Translation: ABS01298.1
EF670712 mRNA Translation: ABS01299.1
FJ226040 mRNA Translation: ACI25172.1
FJ226047 mRNA Translation: ACI25179.1
AF348143 mRNA Translation: AAK30142.1
AY463543 Genomic DNA Translation: AAR18816.1
AL713999 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53116.1
CH471121 Genomic DNA Translation: EAW53117.1
CH471121 Genomic DNA Translation: EAW53118.1
CH471121 Genomic DNA Translation: EAW53119.1
BC120974 mRNA Translation: AAI20975.1
BC120975 mRNA Translation: AAI20976.1
Z17324 mRNA Translation: CAA78972.1
Z17325 mRNA Translation: CAA78973.1
M31823 mRNA Translation: AAA35757.1
S81781 mRNA Translation: AAD14376.1 Different initiation.
S81736 mRNA Translation: AAD14369.1 Different initiation.
M21868 mRNA Translation: AAA59874.1 Sequence problems.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS1098.1 [P15941-8]
CCDS30882.1 [P15941-11]
CCDS30883.1 [P15941-7]
CCDS41408.1 [P15941-12]
CCDS41409.1 [P15941-10]
CCDS55641.1 [P15941-6]
CCDS55642.1 [P15941-13]

Protein sequence database of the Protein Information Resource

More...PIRi		A35175

NCBI Reference Sequences

More...RefSeqi		NP_001018016.1, NM_001018016.2 [P15941-11]
NP_001018017.1, NM_001018017.2 [P15941-7]
NP_001037855.1, NM_001044390.2 [P15941-10]
NP_001037856.1, NM_001044391.2
NP_001037857.1, NM_001044392.2 [P15941-12]
NP_001037858.1, NM_001044393.2
NP_001191214.1, NM_001204285.1
NP_001191215.1, NM_001204286.1
NP_001191216.1, NM_001204287.1
NP_001191217.1, NM_001204288.1
NP_001191218.1, NM_001204289.1
NP_001191219.1, NM_001204290.1
NP_001191220.1, NM_001204291.1
NP_001191221.1, NM_001204292.1
NP_001191222.1, NM_001204293.1 [P15941-13]
NP_001191223.1, NM_001204294.1 [P15941-6]
NP_001191224.1, NM_001204295.1
NP_001191225.1, NM_001204296.1
NP_001191226.1, NM_001204297.1
NP_002447.4, NM_002456.5 [P15941-8]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000337604; ENSP00000338983; ENSG00000185499 [P15941-8]
ENST00000342482; ENSP00000342814; ENSG00000185499 [P15941-16]
ENST00000343256; ENSP00000339690; ENSG00000185499 [P15941-10]
ENST00000368389; ENSP00000357374; ENSG00000185499 [P15941-9]
ENST00000368390; ENSP00000357375; ENSG00000185499 [P15941-7]
ENST00000368392; ENSP00000357377; ENSG00000185499 [P15941-11]
ENST00000368393; ENSP00000357378; ENSG00000185499 [P15941-13]
ENST00000368396; ENSP00000357381; ENSG00000185499 [P15941-12]
ENST00000368398; ENSP00000357383; ENSG00000185499 [P15941-6]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		4582

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:4582

UCSC genome browser

More...UCSCi		uc001fia.4, human [P15941-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Mucin database
NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J05582 mRNA Translation: AAA60019.1
M32738 mRNA Translation: AAA35804.1
M32739 mRNA Translation: AAA35806.1
M34089 mRNA Translation: AAA35807.1
M34088 mRNA Translation: AAA35805.1
J05581 mRNA Translation: AAA59876.1
M61170 Genomic DNA Translation: AAB53150.1
X52229 mRNA Translation: CAA36478.1 Sequence problems.
X52228 mRNA Translation: CAA36477.1 Sequence problems.
M35093 Genomic DNA Translation: AAB59612.1 Sequence problems.
X80761 mRNA Translation: CAA56734.1
U60259 mRNA Translation: AAD10856.1
U60260 mRNA Translation: AAD10857.1
U60261 mRNA Translation: AAD10858.1
AF125525 mRNA Translation: AAD27842.1
AY466157 mRNA Translation: AAR28764.1
AY327582 mRNA Translation: AAP97013.1
AY327584 mRNA Translation: AAP97015.1
AY327586 mRNA Translation: AAP97017.1
AY327587 mRNA Translation: AAP97018.1
EF583653 mRNA Translation: ABQ59628.1
EF670711 mRNA Translation: ABS01298.1
EF670712 mRNA Translation: ABS01299.1
FJ226040 mRNA Translation: ACI25172.1
FJ226047 mRNA Translation: ACI25179.1
AF348143 mRNA Translation: AAK30142.1
AY463543 Genomic DNA Translation: AAR18816.1
AL713999 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53116.1
CH471121 Genomic DNA Translation: EAW53117.1
CH471121 Genomic DNA Translation: EAW53118.1
CH471121 Genomic DNA Translation: EAW53119.1
BC120974 mRNA Translation: AAI20975.1
BC120975 mRNA Translation: AAI20976.1
Z17324 mRNA Translation: CAA78972.1
Z17325 mRNA Translation: CAA78973.1
M31823 mRNA Translation: AAA35757.1
S81781 mRNA Translation: AAD14376.1 Different initiation.
S81736 mRNA Translation: AAD14369.1 Different initiation.
M21868 mRNA Translation: AAA59874.1 Sequence problems.
CCDSiCCDS1098.1 [P15941-8]
CCDS30882.1 [P15941-11]
CCDS30883.1 [P15941-7]
CCDS41408.1 [P15941-12]
CCDS41409.1 [P15941-10]
CCDS55641.1 [P15941-6]
CCDS55642.1 [P15941-13]
PIRiA35175
RefSeqiNP_001018016.1, NM_001018016.2 [P15941-11]
NP_001018017.1, NM_001018017.2 [P15941-7]
NP_001037855.1, NM_001044390.2 [P15941-10]
NP_001037856.1, NM_001044391.2
NP_001037857.1, NM_001044392.2 [P15941-12]
NP_001037858.1, NM_001044393.2
NP_001191214.1, NM_001204285.1
NP_001191215.1, NM_001204286.1
NP_001191216.1, NM_001204287.1
NP_001191217.1, NM_001204288.1
NP_001191218.1, NM_001204289.1
NP_001191219.1, NM_001204290.1
NP_001191220.1, NM_001204291.1
NP_001191221.1, NM_001204292.1
NP_001191222.1, NM_001204293.1 [P15941-13]
NP_001191223.1, NM_001204294.1 [P15941-6]
NP_001191224.1, NM_001204295.1
NP_001191225.1, NM_001204296.1
NP_001191226.1, NM_001204297.1
NP_002447.4, NM_002456.5 [P15941-8]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1SM3X-ray1.95P919-931[»]
2ACMNMR-A1042-1097[»]
B1098-1152[»]
2FO4X-ray2.70P140-146[»]
5T6PX-ray1.97E/F921-928[»]
5T78X-ray2.20E/F921-928[»]
6FZQX-ray1.70P921-926[»]
6FZRX-ray1.80P921-926[»]
6TGGX-ray2.00P921-926[»]
SMRiP15941
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi110669, 147 interactors
DIPiDIP-41890N
IntActiP15941, 121 interactors
MINTiP15941
STRINGi9606.ENSP00000484824

Chemistry databases

ChEMBLiCHEMBL3580494
DrugBankiDB11090, Potassium nitrate
DB06584, TG4010

Protein family/group databases

MEROPSiS71.001

PTM databases

GlyConnecti372, 9 O-Linked glycans
373, 8 O-Linked glycans
374, 8 O-Linked glycans
375, 10 O-Linked glycans
376, 10 O-Linked glycans
377, 7 O-Linked glycans
413, 5 N-Linked glycans (1 site), 14 O-Linked glycans
GlyGeniP15941, 13 sites, 5 O-linked glycans (4 sites)
iPTMnetiP15941
PhosphoSitePlusiP15941
SwissPalmiP15941
UniCarbKBiP15941

Polymorphism and mutation databases

BioMutaiMUC1
DMDMi296439295

Proteomic databases

CPTACiCPTAC-146
CPTAC-147
CPTAC-719
CPTAC-730
jPOSTiP15941
MassIVEiP15941
MaxQBiP15941
PaxDbiP15941
PeptideAtlasiP15941
PRIDEiP15941
ProteomicsDBi1779
53249 [P15941-1]
53250 [P15941-10]
53251 [P15941-2]
53252 [P15941-3]
53253 [P15941-4]
53254 [P15941-5]
53255 [P15941-6]
53256 [P15941-7]
53257 [P15941-8]
53258 [P15941-9]
58806
6245
69255
69256
767

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		P15941, 33 sequenced antibodies

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1298, 4452 antibodies

The CPTC Antibody Portal

More...CPTCi		P15941, 2 antibodies

The DNASU plasmid repository

More...DNASUi		4582

Genome annotation databases

EnsembliENST00000337604; ENSP00000338983; ENSG00000185499 [P15941-8]
ENST00000342482; ENSP00000342814; ENSG00000185499 [P15941-16]
ENST00000343256; ENSP00000339690; ENSG00000185499 [P15941-10]
ENST00000368389; ENSP00000357374; ENSG00000185499 [P15941-9]
ENST00000368390; ENSP00000357375; ENSG00000185499 [P15941-7]
ENST00000368392; ENSP00000357377; ENSG00000185499 [P15941-11]
ENST00000368393; ENSP00000357378; ENSG00000185499 [P15941-13]
ENST00000368396; ENSP00000357381; ENSG00000185499 [P15941-12]
ENST00000368398; ENSP00000357383; ENSG00000185499 [P15941-6]
GeneIDi4582
KEGGihsa:4582
UCSCiuc001fia.4, human [P15941-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		4582
DisGeNETi4582
EuPathDBiHostDB:ENSG00000185499.16

GeneCards: human genes, protein and diseases

More...GeneCardsi		MUC1
GeneReviewsiMUC1
HGNCiHGNC:7508, MUC1
HPAiENSG00000185499, Tissue enhanced (gallbladder, kidney, lung)
MalaCardsiMUC1
MIMi113720, gene
158340, gene
174000, phenotype
neXtProtiNX_P15941
OpenTargetsiENSG00000185499
Orphaneti88949, MUC1-related autosomal dominant tubulointerstitial kidney disease
PharmGKBiPA31309

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QWCT, Eukaryota
GeneTreeiENSGT00710000106874
HOGENOMiCLU_1386987_0_0_1
InParanoidiP15941
OrthoDBi945460at2759
PhylomeDBiP15941

Enzyme and pathway databases

PathwayCommonsiP15941
ReactomeiR-HSA-5083625, Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
R-HSA-5083632, Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)
R-HSA-5083636, Defective GALNT12 causes colorectal cancer 1 (CRCS1)
R-HSA-5621480, Dectin-2 family
R-HSA-6785807, Interleukin-4 and Interleukin-13 signaling
R-HSA-913709, O-linked glycosylation of mucins
R-HSA-977068, Termination of O-glycan biosynthesis
SIGNORiP15941

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		4582, 5 hits in 848 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		MUC1, human
EvolutionaryTraceiP15941

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		MUC1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		4582
PharosiP15941, Tbio

Protein Ontology

More...PROi		PR:P15941
RNActiP15941, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000185499, Expressed in body of stomach and 212 other tissues
ExpressionAtlasiP15941, baseline and differential
GenevisibleiP15941, HS

Family and domain databases

DisProtiDP01790
Gene3Di3.30.70.960, 1 hit
IDEALiIID00195
InterProiView protein in InterPro
IPR023217, Mucin-1
IPR000082, SEA_dom
IPR036364, SEA_dom_sf
PANTHERiPTHR10006, PTHR10006, 7 hits
PfamiView protein in Pfam
PF01390, SEA, 1 hit
SMARTiView protein in SMART
SM00200, SEA, 1 hit
SUPFAMiSSF82671, SSF82671, 1 hit
PROSITEiView protein in PROSITE
PS50024, SEA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMUC1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P15941
Secondary accession number(s): A5YRV1
, A6ZID9, A6ZIE0, B1AVQ8, B1AVR0, B6ECA1, E7ESE5, E7EUG9, P13931, P15942, P17626, Q0VAP5, Q0VAP6, Q14128, Q14876, Q16437, Q16442, Q16615, Q6S4Y3, Q7Z547, Q7Z548, Q7Z550, Q7Z552, Q9BXA4, Q9UE75, Q9UE76, Q9UQL1, Q9Y4J2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: May 18, 2010
Last modified: December 2, 2020
This is version 225 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again