Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mucin-1

Gene

MUC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack.
The beta subunit contains a C-terminal domain which is involved in cell signaling, through phosphorylations and protein-protein interactions. Modulates signaling in ERK, SRC and NF-kappa-B pathways. In activated T-cells, influences directly or indirectly the Ras/MAPK pathway. Promotes tumor progression. Regulates TP53-mediated transcription and determines cell fate in the genotoxic stress response. Binds, together with KLF4, the PE21 promoter element of TP53 and represses TP53 activity.

Miscellaneous

The name KL-6 was originally that of a murine monoclonal antibody reacting with pulmonary adenocarcinoma cell lines and pulmonary epithelial cells. This antibody recognizes a sialylated carbohydrate chain on MUC1.

Caution

O-glycosylation sites are annotated in first sequence repeat only. Residues at similar position are probably glycosylated in all repeats. Experimental sites were determined in a synthetic peptide glycosylated in vitro (PubMed:7744025, PubMed:9597769).2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • p53 binding Source: BHF-UCL
  • RNA polymerase II proximal promoter sequence-specific DNA binding Source: BHF-UCL
  • transcription coregulator activity Source: BHF-UCL

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5083625 Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
R-HSA-5083632 Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)
R-HSA-5083636 Defective GALNT12 causes colorectal cancer 1 (CRCS1)
R-HSA-5621480 Dectin-2 family
R-HSA-6785807 Interleukin-4 and Interleukin-13 signaling
R-HSA-913709 O-linked glycosylation of mucins
R-HSA-977068 Termination of O-glycan biosynthesis

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P15941

Protein family/group databases

MEROPS protease database

More...
MEROPSi
S71.001

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mucin-1
Short name:
MUC-1
Alternative name(s):
Breast carcinoma-associated antigen DF3
Cancer antigen 15-3
Short name:
CA 15-3
Carcinoma-associated mucin
Episialin
H23AG
Krebs von den Lungen-6
Short name:
KL-6
PEMT
Peanut-reactive urinary mucin
Short name:
PUM
Polymorphic epithelial mucin
Short name:
PEM
Tumor-associated epithelial membrane antigen
Short name:
EMA
Tumor-associated mucin
CD_antigen: CD227
Cleaved into the following 2 chains:
Mucin-1 subunit alpha
Short name:
MUC1-NT
Short name:
MUC1-alpha
Mucin-1 subunit beta
Short name:
MUC1-beta
Alternative name(s):
MUC1-CT
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MUC1
Synonyms:PUM
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000185499.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7508 MUC1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
113720 gene
158340 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P15941

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini24 – 1158ExtracellularSequence analysisAdd BLAST1135
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1159 – 1181HelicalSequence analysisAdd BLAST23
Topological domaini1182 – 1255CytoplasmicSequence analysisAdd BLAST74

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

MUC1/CA 15-3 is used as a serological clinical marker of breast cancer to monitor response to breast cancer treatment and disease recurrence (PubMed:20816948). Decreased levels over time may be indicative of a positive response to treatment. Conversely, increased levels may indicate disease progression. At an early stage disease, only 21% of patients exhibit high MUC1/CA 15-3 levels, that is why CA 15-3 is not a useful screening test. Most antibodies target the highly immunodominant core peptide domain of 20 amino acid (APDTRPAPGSTAPPAHGVTS) tandem repeats. Some antibodies recognize glycosylated epitopes.1 Publication
Medullary cystic kidney disease 1 (MCKD1)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of tubulointerstitial nephropathy characterized by formation of renal cysts at the corticomedullary junction. It is characterized by adult onset of impaired renal function and salt wasting resulting in end-stage renal failure by the sixth decade.
See also OMIM:174000

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1098S → A, D, E, F, G, H, I, K, L, M, N, P, Q, R, V, W or Y: Completely abrogates cleavage. 1 Publication1
Mutagenesisi1098S → C or T: Almost complete cleavage. 1 Publication1
Mutagenesisi1116D → A: Greatly reduced formation of isoform 5/isoform Y complex. 1 Publication1
Mutagenesisi1116D → E: No effect on formation of isoform 5/isoform Y complex. 1 Publication1
Mutagenesisi1184C → A: S-palmitoylation reduced by 50%. Complete loss of palmitoylation, no effect on endocytosis, recycling inhibited and AP1S1 binding reduced by 30%; when associated with C-1186. Accumulates in intracellular compartments; when associated with C-1186 and N-1203. 1 Publication1
Mutagenesisi1186C → A: S-palmitoylation reduced by 50%. Complete loss of palmitoylation, no effect on endocytosis, recycling inhibited, and AP1S1 binding reduced by 30%; when associated with C-1184. Accumulates in intracellular compartments; when associated with C-1184 and N-1203. 1 Publication1
Mutagenesisi1187 – 1189RRK → AAA: No nuclear targeting of HRG-stimulated MUC1 C-terminal nor JUP/gamma-catenin. No effect on interaction with JUP/gamma-catenin. 2 Publications3
Mutagenesisi1187 – 1189RRK → QQQ: No effect on palmitoylation. 2 Publications3
Mutagenesisi1191Y → F: No effect on EGFR-mediated phosphorylation. 2 Publications1
Mutagenesisi1191Y → N: No effect on endocytosis. 2 Publications1
Mutagenesisi1203Y → E: No effect on nuclear colocalization of MUC1CT and CTNNB1. No effect on in vitro PDFGR-induced cell invasiveness. 4 Publications1
Mutagenesisi1203Y → F: No effect on EGFR-mediated phosphorylation. No nuclear localization of MUC1CT. Reduced in vitro PDGFR-induced cell invasiveness. 4 Publications1
Mutagenesisi1203Y → N: Reduced endocytosis by 30%. Greatly reduced binding to AP1S2 and GRB2. Binding AP1S1 reduced by 25%. Reduced endocytosis by 77%; when associated with N-1243. Accumulates in intracellular compartments; when associated with C-1184 and C-1186. 4 Publications1
Mutagenesisi1209Y → F: Some reduction in EGFR-mediated phosphorylation. 1 Publication1
Mutagenesisi1218Y → F: No effect on EGFR-mediated phosphorylation. No nuclear colocalization of MUC1CT and CTNNB1. 2 Publications1
Mutagenesisi1223S → A: No change in PRKCD- nor GSK3B-mediated phosphorylation. 2 Publications1
Mutagenesisi1224T → A: Loss of PRKCD-mediated phosphorylation. Decreased PRKCD binding. No increased binding to CTNNB1 in the presence of autophosphorylated PRKCD. Increases formation of E-cadherin/beta-catenin complex. 1 Publication1
Mutagenesisi1227S → A: No change in PRKCD-mediated phosphorylation. Loss of GSK3B-mediated phosphorylation. CTNNB1. 2 Publications1
Mutagenesisi1229Y → F: Greatly reduced EGFR- and Src-mediated phosphorylation. No nuclear localization of MUC1CT. Reduced in vitro PDGFR-mediated phosphorylation. Decreased Src-binding. 4 Publications1
Mutagenesisi1229Y → N: No effect on endocytosis. 4 Publications1
Mutagenesisi1243Y → N: Reduces binding to AP1S2 by 33%. Greatly reduced binding to GRB2. Reduced endocytosis by 50%. Reduced endocytosis by 77%; when associated with N-1203. 1 Publication1

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

DisGeNET

More...
DisGeNETi
4582

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
MUC1

MalaCards human disease database

More...
MalaCardsi
MUC1
MIMi174000 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000185499

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
88949 MUC1-related autosomal dominant tubulointerstitial kidney disease

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31309

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3580494

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MUC1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296439295

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 232 PublicationsAdd BLAST23
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001927724 – 1255Mucin-1Add BLAST1232
ChainiPRO_000031744624 – 1097Mucin-1 subunit alphaAdd BLAST1074
ChainiPRO_00003174471098 – 1255Mucin-1 subunit betaAdd BLAST158

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi131O-linked (GalNAc...) threonine2 Publications1
Glycosylationi139O-linked (GalNAc...) threonine2 Publications1
Glycosylationi140O-linked (GalNAc...) serineSequence analysis1
Glycosylationi144O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi957N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi975N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1029N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1055N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1133N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi1184S-palmitoyl cysteine1 Publication1
Lipidationi1186S-palmitoyl cysteine1 Publication1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1203Phosphotyrosine; by PDGFR2 Publications1
Modified residuei1212Phosphotyrosine1 Publication1
Modified residuei1218Phosphotyrosine; by PDGFR1 Publication1
Modified residuei1224Phosphothreonine; by PKC/PRKCD1 Publication1
Modified residuei1227Phosphoserine; by GSK3-betaCombined sources1 Publication1
Modified residuei1229Phosphotyrosine; by CSK, EGFR and SRC4 Publications1
Modified residuei1243Phosphotyrosine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Highly glycosylated (N- and O-linked carbohydrates and sialic acid). O-glycosylated to a varying degree on serine and threonine residues within each tandem repeat, ranging from mono- to penta-glycosylation. The average density ranges from about 50% in human milk to over 90% in T47D breast cancer cells. Further sialylation occurs during recycling. Membrane-shed glycoproteins from kidney and breast cancer cells have preferentially sialyated core 1 structures, while secreted forms from the same tissues display mainly core 2 structures. The O-glycosylated content is overlapping in both these tissues with terminal fucose and galactose, 2- and 3-linked galactose, 3- and 3,6-linked GalNAc-ol and 4-linked GlcNAc predominating. Differentially O-glycosylated in breast carcinomas with 3,4-linked GlcNAc. N-glycosylation consists of high-mannose, acidic complex-type and hybrid glycans in the secreted form MUC1/SEC, and neutral complex-type in the transmembrane form, MUC1/TM.4 Publications
Proteolytic cleavage in the SEA domain occurs in the endoplasmic reticulum by an autoproteolytic mechanism and requires the full-length SEA domain as well as requiring a Ser, Thr or Cys residue at the P + 1 site. Cleavage at this site also occurs on isoform MUC1/X but not on isoform MUC1/Y. Ectodomain shedding is mediated by ADAM17.3 Publications
Dual palmitoylation on cysteine residues in the CQC motif is required for recycling from endosomes back to the plasma membrane.1 Publication
Phosphorylated on tyrosines and serine residues in the C-terminal. Phosphorylation on tyrosines in the C-terminal increases the nuclear location of MUC1 and beta-catenin. Phosphorylation by PKC delta induces binding of MUC1 to beta-catenin/CTNNB1 and thus decreases the formation of the beta-catenin/E-cadherin complex. Src-mediated phosphorylation inhibits interaction with GSK3B. Src- and EGFR-mediated phosphorylation on Tyr-1229 increases binding to beta-catenin/CTNNB1. GSK3B-mediated phosphorylation on Ser-1227 decreases this interaction but restores the formation of the beta-cadherin/E-cadherin complex. On T-cell receptor activation, phosphorylated by LCK. PDGFR-mediated phosphorylation increases nuclear colocalization of MUC1CT and CTNNB1.11 Publications
The N-terminal sequence has been shown to begin at position 24 or 28.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei1097 – 1098Cleavage; by autolysis2

Keywords - PTMi

Autocatalytic cleavage, Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P15941

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P15941

PeptideAtlas

More...
PeptideAtlasi
P15941

PRoteomics IDEntifications database

More...
PRIDEi
P15941

ProteomicsDB human proteome resource

More...
ProteomicsDBi
53249
53250 [P15941-10]
53251 [P15941-2]
53252 [P15941-3]
53253 [P15941-4]
53254 [P15941-5]
53255 [P15941-6]
53256 [P15941-7]
53257 [P15941-8]
53258 [P15941-9]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
372
373
374
375
376
377
413

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P15941

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P15941

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P15941

UniCarbKB; an annotated and curated database of glycan structures

More...
UniCarbKBi
P15941

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed on the apical surface of epithelial cells, especially of airway passages, breast and uterus. Also expressed in activated and unactivated T-cells. Overexpressed in epithelial tumors, such as breast or ovarian cancer and also in non-epithelial tumor cells. Isoform Y is expressed in tumor cells only.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

During fetal development, expressed at low levels in the colonic epithelium from 13 weeks of gestation.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000185499 Expressed in 199 organ(s), highest expression level in body of stomach

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P15941 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P15941 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB000036
CAB001986
HPA004179
HPA007235
HPA008855

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The alpha subunit forms a tight, non-covalent heterodimeric complex with the proteolytically-released beta-subunit. Interaction, via the tandem repeat region, with domain 1 of ICAM1 is implicated in cell migration and metastases. Isoform 1 binds directly the SH2 domain of GRB2, and forms a MUC1/GRB2/SOS1 complex involved in RAS signaling. The cytoplasmic tail (MUC1CT) interacts with several proteins such as SRC, CTNNB1 and ERBs. Interaction with the SH2 domain of CSK decreases interaction with GSK3B. Interacts with CTNNB1/beta-catenin and JUP/gamma-catenin and promotes cell adhesion. Interaction with JUP/gamma-catenin is induced by heregulin. Binds PRKCD, ERBB2, ERBB3 and ERBB4. Heregulin (HRG) stimulates the interaction with ERBB2 and, to a much lesser extent, the interaction with ERBB3 and ERBB4. Interacts with P53 in response to DNA damage. Interacts with KLF4. Interacts with estrogen receptor alpha/ESR1, through its DNA-binding domain, and stimulates its transcription activity. Binds ADAM17. Isoform ZD forms disulfide-linked oligomers.21 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110669, 44 interactors

Database of interacting proteins

More...
DIPi
DIP-41890N

Protein interaction database and analysis system

More...
IntActi
P15941, 97 interactors

Molecular INTeraction database

More...
MINTi
P15941

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000357380

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11255
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P15941

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P15941

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P15941

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati61 – 801; approximate1 PublicationAdd BLAST20
Repeati81 – 1002; approximate1 PublicationAdd BLAST20
Repeati101 – 12031 PublicationAdd BLAST20
Repeati121 – 14041 PublicationAdd BLAST20
Repeati141 – 16051 PublicationAdd BLAST20
Repeati161 – 18061 PublicationAdd BLAST20
Repeati181 – 20071 PublicationAdd BLAST20
Repeati201 – 22081 PublicationAdd BLAST20
Repeati221 – 24091 PublicationAdd BLAST20
Repeati241 – 260101 PublicationAdd BLAST20
Repeati261 – 280111 PublicationAdd BLAST20
Repeati281 – 300121 PublicationAdd BLAST20
Repeati301 – 320131 PublicationAdd BLAST20
Repeati321 – 340141 PublicationAdd BLAST20
Repeati341 – 360151 PublicationAdd BLAST20
Repeati361 – 380161 PublicationAdd BLAST20
Repeati381 – 400171 PublicationAdd BLAST20
Repeati401 – 420181 PublicationAdd BLAST20
Repeati421 – 440191 PublicationAdd BLAST20
Repeati441 – 460201 PublicationAdd BLAST20
Repeati461 – 480211 PublicationAdd BLAST20
Repeati481 – 500221 PublicationAdd BLAST20
Repeati501 – 520231 PublicationAdd BLAST20
Repeati521 – 540241 PublicationAdd BLAST20
Repeati541 – 560251 PublicationAdd BLAST20
Repeati561 – 580261 PublicationAdd BLAST20
Repeati581 – 600271 PublicationAdd BLAST20
Repeati601 – 620281 PublicationAdd BLAST20
Repeati621 – 640291 PublicationAdd BLAST20
Repeati641 – 660301 PublicationAdd BLAST20
Repeati661 – 680311 PublicationAdd BLAST20
Repeati681 – 700321 PublicationAdd BLAST20
Repeati701 – 720331 PublicationAdd BLAST20
Repeati721 – 740341 PublicationAdd BLAST20
Repeati741 – 760351 PublicationAdd BLAST20
Repeati761 – 780361 PublicationAdd BLAST20
Repeati781 – 800371 PublicationAdd BLAST20
Repeati801 – 820381 PublicationAdd BLAST20
Repeati821 – 840391 PublicationAdd BLAST20
Repeati841 – 860401 PublicationAdd BLAST20
Repeati861 – 880411 PublicationAdd BLAST20
Repeati881 – 900421 PublicationAdd BLAST20
Repeati901 – 920431 PublicationAdd BLAST20
Repeati921 – 940441 PublicationAdd BLAST20
Repeati941 – 960451 PublicationAdd BLAST20
Repeati961 – 98046; approximate1 PublicationAdd BLAST20
Repeati981 – 100047; approximate1 PublicationAdd BLAST20
Repeati1001 – 102048; approximate1 PublicationAdd BLAST20
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1039 – 1148SEAPROSITE-ProRule annotationAdd BLAST110

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni126 – 96542 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-RAdd BLAST840
Regioni1192 – 1228Interaction with P53Add BLAST37
Regioni1223 – 1230Required for interaction with GSK3B8
Regioni1233 – 1241Required for interaction with beta- and gamma-catenins9

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1203 – 1206Interaction with GRB24
Motifi1229 – 1232Interaction with SRC and ESR14
Motifi1243 – 1246Required for interaction with AP1S24

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IX6R Eukaryota
ENOG410ZQ7Z LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00710000106874

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000290201

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG003075

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P15941

KEGG Orthology (KO)

More...
KOi
K06568

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P15941

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.960, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000082 SEA_dom
IPR036364 SEA_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01390 SEA, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00200 SEA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF82671 SSF82671, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50024 SEA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (17+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 17 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 17 described isoforms and 17 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P15941-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTPGTQSPFF LLLLLTVLTV VTGSGHASST PGGEKETSAT QRSSVPSSTE
60 70 80 90 100
KNAVSMTSSV LSSHSPGSGS STTQGQDVTL APATEPASGS AATWGQDVTS
110 120 130 140 150
VPVTRPALGS TTPPAHDVTS APDNKPAPGS TAPPAHGVTS APDTRPAPGS
160 170 180 190 200
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
210 220 230 240 250
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS
260 270 280 290 300
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
310 320 330 340 350
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS
360 370 380 390 400
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
410 420 430 440 450
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS
460 470 480 490 500
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
510 520 530 540 550
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS
560 570 580 590 600
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
610 620 630 640 650
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS
660 670 680 690 700
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
710 720 730 740 750
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS
760 770 780 790 800
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
810 820 830 840 850
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS
860 870 880 890 900
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
910 920 930 940 950
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDNRPALGS
960 970 980 990 1000
TAPPVHNVTS ASGSASGSAS TLVHNGTSAR ATTTPASKST PFSIPSHHSD
1010 1020 1030 1040 1050
TPTTLASHST KTDASSTHHS SVPPLTSSNH STSPQLSTGV SFFFLSFHIS
1060 1070 1080 1090 1100
NLQFNSSLED PSTDYYQELQ RDISEMFLQI YKQGGFLGLS NIKFRPGSVV
1110 1120 1130 1140 1150
VQLTLAFREG TINVHDVETQ FNQYKTEAAS RYNLTISDVS VSDVPFPFSA
1160 1170 1180 1190 1200
QSGAGVPGWG IALLVLVCVL VALAIVYLIA LAVCQCRRKN YGQLDIFPAR
1210 1220 1230 1240 1250
DTYHPMSEYP TYHTHGRYVP PSSTDRSPYE KVSAGNGGSS LSYTNPAVAA

TSANL
Length:1,255
Mass (Da):122,102
Last modified:May 18, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5E28DFC4C20D9A82
GO
Isoform 2 (identifier: P15941-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT

Show »
Length:1,264
Mass (Da):122,941
Checksum:i3810149471D221FD
GO
Isoform 3 (identifier: P15941-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     19-21: Missing.

Show »
Length:1,252
Mass (Da):121,803
Checksum:iA3F30DBFE56DD0C5
GO
Isoform 4 (identifier: P15941-4) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     20-31: Missing.

Show »
Length:1,243
Mass (Da):121,021
Checksum:iB2C6288C94AABC14
GO
Isoform 5 (identifier: P15941-5) [UniParc]FASTAAdd to basket
Also known as: SEC

The sequence of this isoform differs from the canonical sequence as follows:
     1077-1087: FLQIYKQGGFL → VSIGLSFPMLP
     1088-1255: Missing.

Show »
Length:1,087
Mass (Da):103,836
Checksum:i6039CBB69974EA3E
GO
Isoform 6 (identifier: P15941-6) [UniParc]FASTAAdd to basket
Also known as: X

The sequence of this isoform differs from the canonical sequence as follows:
     54-70: VSMTSSVLSSHSPGSGS → IPAPTTTKSCRETFLKW
     71-1095: Missing.

Show »
Length:230
Mass (Da):24,566
Checksum:i53B036250EC1242D
GO
Isoform Y (identifier: P15941-7) [UniParc]FASTAAdd to basket
Also known as: MUC1/Y

The sequence of this isoform differs from the canonical sequence as follows:
     54-1053: Missing.

Show »
Length:255
Mass (Da):27,566
Checksum:i46DC2580CF357BEF
GO
Isoform 8 (identifier: P15941-8) [UniParc]FASTAAdd to basket
Also known as: Z

The sequence of this isoform differs from the canonical sequence as follows:
     54-1035: Missing.

Show »
Length:273
Mass (Da):29,592
Checksum:iB72F7F4FC2D23BCC
GO
Isoform 9 (identifier: P15941-9) [UniParc]FASTAAdd to basket
Also known as: S

The sequence of this isoform differs from the canonical sequence as follows:
     54-1035: Missing.
     1077-1181: Missing.

Show »
Length:168
Mass (Da):18,277
Checksum:i53C6544C2B077B89
GO
Isoform F (identifier: P15941-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     54-87: VSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPA → IPAPTTTKSCRETFLKCFCRFINKGVFWASPILS
     88-1139: Missing.

Show »
Length:203
Mass (Da):21,556
Checksum:iCC2BE70F8C1B325E
GO
Isoform Y-LSP (identifier: P15941-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT
     54-1053: Missing.

Note: Lacks the mucin repeats.
Show »
Length:264
Mass (Da):28,405
Checksum:i6E192550756A6D4A
GO
Isoform S2 (identifier: P15941-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT
     54-1053: Missing.
     1077-1181: Missing.

Show »
Length:159
Mass (Da):17,090
Checksum:i2C3B69F515D73168
GO
Isoform M6 (identifier: P15941-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     54-1035: Missing.
     1141-1180: VSDVPFPFSA...VALAIVYLIA → GCLSVPPKEL...LPHPWALCAP
     1181-1255: Missing.

Show »
Length:198
Mass (Da):21,663
Checksum:i5300166458B017CB
GO
Isoform ZD (identifier: P15941-14) [UniParc]FASTAAdd to basket
Also known as: J19

The sequence of this isoform differs from the canonical sequence as follows:
     54-96: VSMTSSVLSS...ASGSAATWGQ → IPAPTTTKSC...SSGQDLWWYN
     97-1255: Missing.

Note: Lacks the mucin repeats. Exists as a disulfide-linked oligomer.
Show »
Length:96
Mass (Da):10,403
Checksum:iF2140812C4C11983
GO
Isoform T10 (identifier: P15941-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT
     54-1093: Missing.

Show »
Length:224
Mass (Da):23,747
Checksum:i977E7703C14AC936
GO
Isoform E2 (identifier: P15941-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT
     54-1151: Missing.

Show »
Length:166
Mass (Da):17,287
Checksum:iBF6C969984986AD0
GO
Isoform J13 (identifier: P15941-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT
     54-1053: Missing.
     1232-1255: VSAGNGGSSLSYTNPAVAATSANL → RQNGWSTMPRGALPEESQG

Show »
Length:259
Mass (Da):28,297
Checksum:iFD53C9223E24B094
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 17 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X2A4A0A087X2A4_HUMAN
Mucin-1
MUC1
484Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGW3A0A0C4DGW3_HUMAN
Mucin-1
MUC1
475Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A6ZIE4A6ZIE4_HUMAN
MUC1 isoform M10
MUC1
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MRB3A0A0A0MRB3_HUMAN
Mucin-1
MUC1
241Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AVQ7B1AVQ7_HUMAN
Mucin-1
MUC1
229Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WWM1A0A087WWM1_HUMAN
Mucin-1
MUC1
1,262Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X0L2A0A087X0L2_HUMAN
Mucin-1
MUC1
239Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSH4A0A0A0MSH4_HUMAN
Mucin-1
MUC1
268Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A6ZIE3A6ZIE3_HUMAN
MUC1 isoform M9
MUC1
213Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WVJ0A0A087WVJ0_HUMAN
Mucin-1
MUC1
228Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD14369 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAD14376 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti2T → A in AAD14369 (PubMed:8604237).Curated1
Sequence conflicti134P → Q in AAA35757 (PubMed:2597151).Curated1
Sequence conflicti154P → Q in AAA35757 (PubMed:2597151).Curated1
Sequence conflicti1021S → T in AAA35805 (PubMed:2318825).Curated1
Sequence conflicti1021S → T in AAA35807 (PubMed:2318825).Curated1
Sequence conflicti1021S → T in AAA59876 (PubMed:1697589).Curated1
Sequence conflicti1143D → G in AAP97018 (PubMed:22941036).Curated1
Sequence conflicti1193Q → L in AAK30142 (PubMed:15969018).Curated1
Sequence conflicti1231K → T in AAD10858 (PubMed:9212228).Curated1
Sequence conflicti1251T → A in AAA60019 (PubMed:2394722).Curated1

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

The number of repeats is highly polymorphic. It varies from 21 to 125 in the northern European population. The most frequent alleles contains 41 and 85 repeats. The tandemly repeated icosapeptide underlies polymorphism at three positions: PAPGSTAP[PAQT]AHGVTSAP[DT/ES]R, DT -> ES and the single replacements P -> A, P -> Q and P-> T. The most frequent replacement DT -> ES occurs in up to 50% of the repeats.

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0193901117V → M3 PublicationsCorresponds to variant dbSNP:rs1611770Ensembl.1
Natural variantiVAR_0193911142S → N1 PublicationCorresponds to variant dbSNP:rs11465207Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00328119 – 21Missing in isoform 3. 1 Publication3
Alternative sequenceiVSP_00328019T → TATTAPKPAT in isoform 2, isoform Y-LSP, isoform E2, isoform J13, isoform S2 and isoform T10. 6 Publications1
Alternative sequenceiVSP_00328220 – 31Missing in isoform 4. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_04787254 – 1151Missing in isoform E2. 1 PublicationAdd BLAST1098
Alternative sequenceiVSP_04787354 – 1093Missing in isoform T10. 1 PublicationAdd BLAST1040
Alternative sequenceiVSP_00328554 – 1053Missing in isoform J13, isoform Y, isoform Y-LSP and isoform S2. 6 PublicationsAdd BLAST1000
Alternative sequenceiVSP_00328654 – 1035Missing in isoform 8, isoform 9 and isoform M6. 4 PublicationsAdd BLAST982
Alternative sequenceiVSP_04757554 – 96VSMTS…ATWGQ → IPAPTTTKSCRETFLKCFCR FINKGVFWASPILSSGQDLW WYN in isoform ZD. 2 PublicationsAdd BLAST43
Alternative sequenceiVSP_03504654 – 87VSMTS…ATEPA → IPAPTTTKSCRETFLKCFCR FINKGVFWASPILS in isoform F. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_00328354 – 70VSMTS…PGSGS → IPAPTTTKSCRETFLKW in isoform 6. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_00328471 – 1095Missing in isoform 6. 2 PublicationsAdd BLAST1025
Alternative sequenceiVSP_03504788 – 1139Missing in isoform F. 1 PublicationAdd BLAST1052
Alternative sequenceiVSP_04757697 – 1255Missing in isoform ZD. 2 PublicationsAdd BLAST1159
Alternative sequenceiVSP_0032871077 – 1181Missing in isoform 9 and isoform S2. 3 PublicationsAdd BLAST105
Alternative sequenceiVSP_0032881077 – 1087FLQIYKQGGFL → VSIGLSFPMLP in isoform 5. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_0032891088 – 1255Missing in isoform 5. 1 PublicationAdd BLAST168
Alternative sequenceiVSP_0469621141 – 1180VSDVP…VYLIA → GCLSVPPKELRAAGHLSSPG YLPSYERVPHLPHPWALCAP in isoform M6. 2 PublicationsAdd BLAST40
Alternative sequenceiVSP_0469631181 – 1255Missing in isoform M6. 2 PublicationsAdd BLAST75
Alternative sequenceiVSP_0478741232 – 1255VSAGN…TSANL → RQNGWSTMPRGALPEESQG in isoform J13. 1 PublicationAdd BLAST24

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
J05582 mRNA Translation: AAA60019.1
M32738 mRNA Translation: AAA35804.1
M32739 mRNA Translation: AAA35806.1
M34089 mRNA Translation: AAA35807.1
M34088 mRNA Translation: AAA35805.1
J05581 mRNA Translation: AAA59876.1
M61170 Genomic DNA Translation: AAB53150.1
X52229 mRNA Translation: CAA36478.1 Sequence problems.
X52228 mRNA Translation: CAA36477.1 Sequence problems.
M35093 Genomic DNA Translation: AAB59612.1 Sequence problems.
X80761 mRNA Translation: CAA56734.1
U60259 mRNA Translation: AAD10856.1
U60260 mRNA Translation: AAD10857.1
U60261 mRNA Translation: AAD10858.1
AF125525 mRNA Translation: AAD27842.1
AY466157 mRNA Translation: AAR28764.1
AY327582 mRNA Translation: AAP97013.1
AY327584 mRNA Translation: AAP97015.1
AY327586 mRNA Translation: AAP97017.1
AY327587 mRNA Translation: AAP97018.1
EF583653 mRNA Translation: ABQ59628.1
EF670711 mRNA Translation: ABS01298.1
EF670712 mRNA Translation: ABS01299.1
FJ226040 mRNA Translation: ACI25172.1
FJ226047 mRNA Translation: ACI25179.1
AF348143 mRNA Translation: AAK30142.1
AY463543 Genomic DNA Translation: AAR18816.1
AL713999 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53116.1
CH471121 Genomic DNA Translation: EAW53117.1
CH471121 Genomic DNA Translation: EAW53118.1
CH471121 Genomic DNA Translation: EAW53119.1
BC120974 mRNA Translation: AAI20975.1
BC120975 mRNA Translation: AAI20976.1
Z17324 mRNA Translation: CAA78972.1
Z17325 mRNA Translation: CAA78973.1
M31823 mRNA Translation: AAA35757.1
S81781 mRNA Translation: AAD14376.1 Different initiation.
S81736 mRNA Translation: AAD14369.1 Different initiation.
M21868 mRNA Translation: AAA59874.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1098.1 [P15941-8]
CCDS30882.1 [P15941-11]
CCDS30883.1 [P15941-7]
CCDS41408.1 [P15941-12]
CCDS41409.1 [P15941-10]
CCDS55641.1 [P15941-6]
CCDS55642.1 [P15941-13]

Protein sequence database of the Protein Information Resource

More...
PIRi
A35175

NCBI Reference Sequences

More...
RefSeqi
NP_001018016.1, NM_001018016.2 [P15941-11]
NP_001018017.1, NM_001018017.2 [P15941-7]
NP_001037855.1, NM_001044390.2 [P15941-10]
NP_001037856.1, NM_001044391.2
NP_001037857.1, NM_001044392.2 [P15941-12]
NP_001037858.1, NM_001044393.2
NP_001191214.1, NM_001204285.1
NP_001191215.1, NM_001204286.1
NP_001191216.1, NM_001204287.1
NP_001191217.1, NM_001204288.1
NP_001191218.1, NM_001204289.1
NP_001191219.1, NM_001204290.1
NP_001191220.1, NM_001204291.1
NP_001191221.1, NM_001204292.1
NP_001191222.1, NM_001204293.1 [P15941-13]
NP_001191223.1, NM_001204294.1 [P15941-6]
NP_001191224.1, NM_001204295.1
NP_001191225.1, NM_001204296.1
NP_001191226.1, NM_001204297.1
NP_002447.4, NM_002456.5 [P15941-8]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.89603

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000337604; ENSP00000338983; ENSG00000185499 [P15941-8]
ENST00000342482; ENSP00000342814; ENSG00000185499 [P15941-16]
ENST00000343256; ENSP00000339690; ENSG00000185499 [P15941-10]
ENST00000368389; ENSP00000357374; ENSG00000185499 [P15941-9]
ENST00000368390; ENSP00000357375; ENSG00000185499 [P15941-7]
ENST00000368392; ENSP00000357377; ENSG00000185499 [P15941-11]
ENST00000368393; ENSP00000357378; ENSG00000185499 [P15941-13]
ENST00000368396; ENSP00000357381; ENSG00000185499 [P15941-12]
ENST00000368398; ENSP00000357383; ENSG00000185499 [P15941-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4582

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4582

UCSC genome browser

More...
UCSCi
uc001fia.4 human [P15941-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Mucin database
NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J05582 mRNA Translation: AAA60019.1
M32738 mRNA Translation: AAA35804.1
M32739 mRNA Translation: AAA35806.1
M34089 mRNA Translation: AAA35807.1
M34088 mRNA Translation: AAA35805.1
J05581 mRNA Translation: AAA59876.1
M61170 Genomic DNA Translation: AAB53150.1
X52229 mRNA Translation: CAA36478.1 Sequence problems.
X52228 mRNA Translation: CAA36477.1 Sequence problems.
M35093 Genomic DNA Translation: AAB59612.1 Sequence problems.
X80761 mRNA Translation: CAA56734.1
U60259 mRNA Translation: AAD10856.1
U60260 mRNA Translation: AAD10857.1
U60261 mRNA Translation: AAD10858.1
AF125525 mRNA Translation: AAD27842.1
AY466157 mRNA Translation: AAR28764.1
AY327582 mRNA Translation: AAP97013.1
AY327584 mRNA Translation: AAP97015.1
AY327586 mRNA Translation: AAP97017.1
AY327587 mRNA Translation: AAP97018.1
EF583653 mRNA Translation: ABQ59628.1
EF670711 mRNA Translation: ABS01298.1
EF670712 mRNA Translation: ABS01299.1
FJ226040 mRNA Translation: ACI25172.1
FJ226047 mRNA Translation: ACI25179.1
AF348143 mRNA Translation: AAK30142.1
AY463543 Genomic DNA Translation: AAR18816.1
AL713999 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53116.1
CH471121 Genomic DNA Translation: EAW53117.1
CH471121 Genomic DNA Translation: EAW53118.1
CH471121 Genomic DNA Translation: EAW53119.1
BC120974 mRNA Translation: AAI20975.1
BC120975 mRNA Translation: AAI20976.1
Z17324 mRNA Translation: CAA78972.1
Z17325 mRNA Translation: CAA78973.1
M31823 mRNA Translation: AAA35757.1
S81781 mRNA Translation: AAD14376.1 Different initiation.
S81736 mRNA Translation: AAD14369.1 Different initiation.
M21868 mRNA Translation: AAA59874.1 Sequence problems.
CCDSiCCDS1098.1 [P15941-8]
CCDS30882.1 [P15941-11]
CCDS30883.1 [P15941-7]
CCDS41408.1 [P15941-12]
CCDS41409.1 [P15941-10]
CCDS55641.1 [P15941-6]
CCDS55642.1 [P15941-13]
PIRiA35175
RefSeqiNP_001018016.1, NM_001018016.2 [P15941-11]
NP_001018017.1, NM_001018017.2 [P15941-7]
NP_001037855.1, NM_001044390.2 [P15941-10]
NP_001037856.1, NM_001044391.2
NP_001037857.1, NM_001044392.2 [P15941-12]
NP_001037858.1, NM_001044393.2
NP_001191214.1, NM_001204285.1
NP_001191215.1, NM_001204286.1
NP_001191216.1, NM_001204287.1
NP_001191217.1, NM_001204288.1
NP_001191218.1, NM_001204289.1
NP_001191219.1, NM_001204290.1
NP_001191220.1, NM_001204291.1
NP_001191221.1, NM_001204292.1
NP_001191222.1, NM_001204293.1 [P15941-13]
NP_001191223.1, NM_001204294.1 [P15941-6]
NP_001191224.1, NM_001204295.1
NP_001191225.1, NM_001204296.1
NP_001191226.1, NM_001204297.1
NP_002447.4, NM_002456.5 [P15941-8]
UniGeneiHs.89603

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1SM3X-ray1.95P919-931[»]
2ACMNMR-A1042-1097[»]
B1098-1152[»]
2FO4X-ray2.70P140-146[»]
5T6PX-ray1.97E/F921-928[»]
5T78X-ray2.20E/F921-928[»]
ProteinModelPortaliP15941
SMRiP15941
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110669, 44 interactors
DIPiDIP-41890N
IntActiP15941, 97 interactors
MINTiP15941
STRINGi9606.ENSP00000357380

Chemistry databases

ChEMBLiCHEMBL3580494

Protein family/group databases

MEROPSiS71.001

PTM databases

GlyConnecti372
373
374
375
376
377
413
iPTMnetiP15941
PhosphoSitePlusiP15941
SwissPalmiP15941
UniCarbKBiP15941

Polymorphism and mutation databases

BioMutaiMUC1
DMDMi296439295

Proteomic databases

MaxQBiP15941
PaxDbiP15941
PeptideAtlasiP15941
PRIDEiP15941
ProteomicsDBi53249
53250 [P15941-10]
53251 [P15941-2]
53252 [P15941-3]
53253 [P15941-4]
53254 [P15941-5]
53255 [P15941-6]
53256 [P15941-7]
53257 [P15941-8]
53258 [P15941-9]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4582
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000337604; ENSP00000338983; ENSG00000185499 [P15941-8]
ENST00000342482; ENSP00000342814; ENSG00000185499 [P15941-16]
ENST00000343256; ENSP00000339690; ENSG00000185499 [P15941-10]
ENST00000368389; ENSP00000357374; ENSG00000185499 [P15941-9]
ENST00000368390; ENSP00000357375; ENSG00000185499 [P15941-7]
ENST00000368392; ENSP00000357377; ENSG00000185499 [P15941-11]
ENST00000368393; ENSP00000357378; ENSG00000185499 [P15941-13]
ENST00000368396; ENSP00000357381; ENSG00000185499 [P15941-12]
ENST00000368398; ENSP00000357383; ENSG00000185499 [P15941-6]
GeneIDi4582
KEGGihsa:4582
UCSCiuc001fia.4 human [P15941-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4582
DisGeNETi4582
EuPathDBiHostDB:ENSG00000185499.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MUC1
GeneReviewsiMUC1
HGNCiHGNC:7508 MUC1
HPAiCAB000036
CAB001986
HPA004179
HPA007235
HPA008855
MalaCardsiMUC1
MIMi113720 gene
158340 gene
174000 phenotype
neXtProtiNX_P15941
OpenTargetsiENSG00000185499
Orphaneti88949 MUC1-related autosomal dominant tubulointerstitial kidney disease
PharmGKBiPA31309

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IX6R Eukaryota
ENOG410ZQ7Z LUCA
GeneTreeiENSGT00710000106874
HOGENOMiHOG000290201
HOVERGENiHBG003075
InParanoidiP15941
KOiK06568
PhylomeDBiP15941

Enzyme and pathway databases

ReactomeiR-HSA-5083625 Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
R-HSA-5083632 Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)
R-HSA-5083636 Defective GALNT12 causes colorectal cancer 1 (CRCS1)
R-HSA-5621480 Dectin-2 family
R-HSA-6785807 Interleukin-4 and Interleukin-13 signaling
R-HSA-913709 O-linked glycosylation of mucins
R-HSA-977068 Termination of O-glycan biosynthesis
SIGNORiP15941

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MUC1 human
EvolutionaryTraceiP15941

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MUC1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4582

Protein Ontology

More...
PROi
PR:P15941

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000185499 Expressed in 199 organ(s), highest expression level in body of stomach
ExpressionAtlasiP15941 baseline and differential
GenevisibleiP15941 HS

Family and domain databases

Gene3Di3.30.70.960, 1 hit
InterProiView protein in InterPro
IPR000082 SEA_dom
IPR036364 SEA_dom_sf
PfamiView protein in Pfam
PF01390 SEA, 1 hit
SMARTiView protein in SMART
SM00200 SEA, 1 hit
SUPFAMiSSF82671 SSF82671, 1 hit
PROSITEiView protein in PROSITE
PS50024 SEA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMUC1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P15941
Secondary accession number(s): A5YRV1
, A6ZID9, A6ZIE0, B1AVQ8, B1AVR0, B6ECA1, E7ESE5, E7EUG9, P13931, P15942, P17626, Q0VAP5, Q0VAP6, Q14128, Q14876, Q16437, Q16442, Q16615, Q6S4Y3, Q7Z547, Q7Z548, Q7Z550, Q7Z552, Q9BXA4, Q9UE75, Q9UE76, Q9UQL1, Q9Y4J2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: May 18, 2010
Last modified: November 7, 2018
This is version 210 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again