Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - P15692 (VEGFA_HUMAN)

Entry version 258 (25 May 2022)
Sequence version 2 (16 Nov 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Vascular endothelial growth factor A

Gene

VEGFA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity).

Also binds the DEAR/FBXW7-AS1 receptor (PubMed:17446437).

By similarity4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Growth factor, Heparin-binding, Mitogen
Biological processAngiogenesis, Differentiation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P15692

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-114608, Platelet degranulation
R-HSA-1234158, Regulation of gene expression by Hypoxia-inducible Factor
R-HSA-194138, Signaling by VEGF
R-HSA-194313, VEGF ligand-receptor interactions
R-HSA-195399, VEGF binds to VEGFR leading to receptor dimerization
R-HSA-4420097, VEGFA-VEGFR2 Pathway [P15692-4]
R-HSA-5218921, VEGFR2 mediated cell proliferation [P15692-4]
R-HSA-6785807, Interleukin-4 and Interleukin-13 signaling
R-HSA-8866910, TFAP2 (AP-2) family regulates transcription of growth factors and their receptors
R-HSA-9679191, Potential therapeutics for SARS [P15692-4]

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P15692

SIGNOR Signaling Network Open Resource

More...SIGNORi		P15692

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...MoonDBi		P15692, Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Vascular endothelial growth factor A
Short name:
VEGF-A
Alternative name(s):
Vascular permeability factor
Short name:
VPF
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:VEGFA
Synonyms:VEGF
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:12680, VEGFA

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		192240, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P15692

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000112715

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Microvascular complications of diabetes 1 (MVCD1)1 Publication
Disease susceptibility is associated with variants affecting the gene represented in this entry.
Disease descriptionPathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.
Related information in OMIM

Organism-specific databases

DisGeNET

More...DisGeNETi		7422

MalaCards human disease database

More...MalaCardsi		VEGFA
MIMi603933, phenotype

Open Targets

More...OpenTargetsi		ENSG00000112715

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA37302

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P15692, Tclin

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1783

Drug and drug target database

More...DrugBanki		DB05434, ABT-510
DB08885, Aflibercept
DB00112, Bevacizumab
DB06642, Bevasiranib
DB14864, Brolucizumab
DB01136, Carvedilol
DB09301, Chondroitin sulfate
DB06779, Dalteparin
DB05932, Denibulin
DB15303, Faricimab
DB10772, Foreskin keratinocyte (neonatal)
DB01120, Gliclazide
DB01017, Minocycline
DB04895, Pegaptanib
DB03088, Pidolic acid
DB01270, Ranibizumab
DB05969, SNS-032
DB05294, Vandetanib
DB05890, Veglin

DrugCentral

More...DrugCentrali		P15692

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		VEGFA

Domain mapping of disease mutations (DMDM)

More...DMDMi		17380528

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 262 PublicationsAdd BLAST26
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002338627 – 232Vascular endothelial growth factor AAdd BLAST206

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi52 ↔ 94
Disulfide bondi77Interchain
Disulfide bondi83 ↔ 128
Disulfide bondi86Interchain
Disulfide bondi87 ↔ 130
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi101N-linked (GlcNAc...) asparagine1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P15692

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P15692

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P15692

PeptideAtlas

More...PeptideAtlasi		P15692

PRoteomics IDEntifications database

More...PRIDEi		P15692

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		34350
34645
34652
34682
35749
40743
53195 [P15692-1]
53196 [P15692-10]
53197 [P15692-11]
53198 [P15692-12]
53199 [P15692-13]
53200 [P15692-14]
53201 [P15692-2]
53202 [P15692-3]
53203 [P15692-4]
53204 [P15692-5]
53205 [P15692-6]
53206 [P15692-8]
53207 [P15692-9]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P15692, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P15692

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P15692

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed. A higher level expression seen in pituitary tumors as compared to the pituitary gland.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By hypoxia. Regulated by growth factors, cytokines, gonadotropins, nitric oxide, hypoglycemia and oncogenic mutations.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000112715, Expressed in left lobe of thyroid gland and 240 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P15692, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P15692, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000112715, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; disulfide-linked (By similarity). Also found as heterodimer with PGF (By similarity).

Interacts with NRP1 (PubMed:26503042).

Interacts with isoform 2 of BSG (PubMed:25825981).

By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		113265, 62 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-1977, Vascular endothelial growth factor A complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P15692

Database of interacting proteins

More...DIPi		DIP-5740N

Protein interaction database and analysis system

More...IntActi		P15692, 24 interactors

Molecular INTeraction database

More...MINTi		P15692

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000478570

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P15692

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P15692, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1232
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		P15692

Biological Magnetic Resonance Data Bank

More...BMRBi		P15692

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P15692

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P15692

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni132 – 161DisorderedSequence analysisAdd BLAST30

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi145 – 161Basic residuesSequence analysisAdd BLAST17

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PDGF/VEGF growth factor family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QVI8, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157284

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_042996_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P15692

Identification of Orthologs from Complete Genome Data

More...OMAi		NCAERRK

Database for complete collections of gene phylogenies

More...PhylomeDBi		P15692

Family and domain databases

Conserved Domains Database

More...CDDi		cd00135, PDGF, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.10.160.10, 1 hit
2.10.90.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR029034, Cystine-knot_cytokine
IPR023581, PD_growth_factor_CS
IPR000072, PDGF/VEGF_dom
IPR027928, VEGF_C
IPR036841, VEGF_C_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00341, PDGF, 1 hit
PF14554, VEGF_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00141, PDGF, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57501, SSF57501, 1 hit
SSF57593, SSF57593, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00249, PDGF_1, 1 hit
PS50278, PDGF_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (17+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 17 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage, alternative splicing and alternative initiation. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 17 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform VEGF206 (identifier: P15692-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNFLLSWVHW SLALLLYLHH AKWSQAAPMA EGGGQNHHEV VKFMDVYQRS 
        60         70         80         90        100
YCHPIETLVD IFQEYPDEIE YIFKPSCVPL MRCGGCCNDE GLECVPTEES 
       110        120        130        140        150
NITMQIMRIK PHQGQHIGEM SFLQHNKCEC RPKKDRARQE KKSVRGKGKG 
       160        170        180        190        200
QKRKRKKSRY KSWSVYVGAR CCLMPWSLPG PHPCGPCSER RKHLFVQDPQ 
       210        220        230 
TCKCSCKNTD SRCKARQLEL NERTCRCDKP RR
Length:232
Mass (Da):27,042
Last modified:November 16, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFB49F364446F4D01
GO
Isoform VEGF189 (identifier: P15692-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     166-182: Missing.

Show »
Length:215
Mass (Da):25,173
Checksum:i7B9759AD5871FF33
GO
Isoform VEGF183 (identifier: P15692-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     160-182: Missing.

Show »
Length:209
Mass (Da):24,422
Checksum:iF01CCEACD945D6CA
GO
Isoform VEGF165 (identifier: P15692-4) [UniParc]FASTAAdd to basket
Also known as: VEGF

The sequence of this isoform differs from the canonical sequence as follows:
     141-141: K → N
     142-182: Missing.

Show »
Length:191
Mass (Da):22,314
Checksum:iCCE57097DD3779BD
GO
Isoform VEGF148 (identifier: P15692-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-141: K → N
     142-182: Missing.
     215-215: A → M
     216-232: Missing.

Show »
Length:174
Mass (Da):20,218
Checksum:iAE88400CA7757644
GO
Isoform VEGF145 (identifier: P15692-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     166-226: Missing.

Show »
Length:171
Mass (Da):20,064
Checksum:iD02ECA735FF6E9F8
GO
Isoform VEGF165B (identifier: P15692-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-141: K → N
     142-182: Missing.
     227-232: CDKPRR → SLTRKD

Show »
Length:191
Mass (Da):22,259
Checksum:iD25243E540AC79BD
GO
Isoform VEGF121 (identifier: P15692-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     142-226: Missing.

Show »
Length:147
Mass (Da):17,219
Checksum:iDDF4D6994249BED6
GO
Isoform VEGF111 (identifier: P15692-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     132-226: Missing.

Show »
Length:137
Mass (Da):15,981
Checksum:i196B2BB49381BE87
GO
Isoform L-VEGF165 (identifier: P15692-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTDRQTDTAP...AGPGRASETM
     141-141: K → N
     142-182: Missing.

Note: Produced by alternative promoter usage and alternative initiation. Starts at an alternative upstream CUG codon. Post-translationally processed to produce the secreted VEGF peptide and a N-terminal peptide N-VEGF. The unprocessed protein and the N-VEGF peptide may localize to the nucleus (PubMed:15896327), the endoplasmic reticulum and the Golgi (PubMed:11731620) or the extracellular matrix (PubMed:11563986).3 Publications
Show »
Length:371
Mass (Da):40,738
Checksum:i053E9CA56725C07B
GO
Isoform L-VEGF121 (identifier: P15692-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTDRQTDTAP...AGPGRASETM
     142-226: Missing.

Note: Produced by alternative promoter usage and alternative initiation. Starts at an alternative upstream CUG codon. Post-translationally processed to produce the secreted VEGF peptide and a N-terminal peptide N-VEGF. The unprocessed protein and the N-VEGF peptide may localize to the nucleus (PubMed:15896327), the endoplasmic reticulum and the Golgi (PubMed:11731620) or the extracellular matrix (PubMed:11563986).3 Publications
Show »
Length:327
Mass (Da):35,643
Checksum:i8D6F969601B2A9EF
GO
Isoform L-VEGF189 (identifier: P15692-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTDRQTDTAP...AGPGRASETM
     166-182: Missing.

Note: Produced by alternative promoter usage and alternative initiation. Starts at an alternative upstream CUG codon. Post-translationally processed to produce the secreted VEGF peptide and a N-terminal peptide N-VEGF. The unprocessed protein and the N-VEGF peptide may localize to the nucleus (PubMed:15896327), the endoplasmic reticulum and the Golgi (PubMed:11731620) or the extracellular matrix (PubMed:11563986).3 Publications
Show »
Length:395
Mass (Da):43,597
Checksum:i8ADF6524B1835A2D
GO
Isoform L-VEGF206 (identifier: P15692-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTDRQTDTAP...AGPGRASETM

Note: Produced by alternative promoter usage and alternative initiation. Starts at an alternative upstream CUG codon.Curated
Show »
Length:412
Mass (Da):45,467
Checksum:iAC807D3F21528D35
GO
Isoform 15 (identifier: P15692-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTDRQTDTAP...AGPGRASETM
     141-182: KKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPH → N
     227-232: CDKPRR → SLTRKD

Note: Starts at an alternative upstream CUG codon.Curated
Show »
Length:371
Mass (Da):40,683
Checksum:i1B89AFD7FABEC07B
GO
Isoform 16 (identifier: P15692-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTDRQTDTAP...AGPGRASETM
     160-182: Missing.

Note: Starts at an alternative upstream CUG codon.Curated
Show »
Length:389
Mass (Da):42,846
Checksum:i950279CF7A273A0E
GO
Isoform 17 (identifier: P15692-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTDRQTDTAP...AGPGRASETM
     141-182: KKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPH → N
     215-215: A → M
     216-232: Missing.

Note: Starts at an alternative upstream CUG codon.Curated
Show »
Length:354
Mass (Da):38,642
Checksum:i0152409399BAB1EB
GO
Isoform 18 (identifier: P15692-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTDRQTDTAP...AGPGRASETM
     132-226: Missing.

Note: Starts at an alternative upstream CUG codon.Curated
Show »
Length:317
Mass (Da):34,406
Checksum:iFDF27C1251E3B613
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KPA4J3KPA4_HUMAN
Vascular endothelial growth factor ...
VEGFA
412Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSI7A0A0A0MSI7_HUMAN
Vascular endothelial growth factor ...
VEGFA
389Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSH5A0A0A0MSH5_HUMAN
Vascular endothelial growth factor ...
VEGFA
395Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BLW8H3BLW8_HUMAN
Vascular endothelial growth factor ...
VEGFA
371Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSH7A0A0A0MSH7_HUMAN
Vascular endothelial growth factor ...
VEGFA
354Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MTB2A0A0A0MTB2_HUMAN
Vascular endothelial growth factor ...
VEGFA
371Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9ZH41A0A5F9ZH41_HUMAN
Vascular endothelial growth factor ...
VEGFA
393Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2A2V4A2A2V4_HUMAN
Vascular endothelial growth factor ...
VEGFA
163Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBI8H0YBI8_HUMAN
Vascular endothelial growth factor ...
VEGFA
111Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBZ0H0YBZ0_HUMAN
Vascular endothelial growth factor ...
VEGFA
323Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC63102 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAC63143 differs from that shown. Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti87C → S in AAC63143 (PubMed:9450968).Curated1
Sequence conflicti210D → H in AAC63143 (PubMed:9450968).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0387451M → MTDRQTDTAPSPSYHLLPGR RRTVDAAASRGQGPEPAPGG GVEGVGARGVALKLFVQLLG CSRFGGAVVRAGEAEPSGAA RSASSGREEPQPEEGEEEEE KEEERGPQWRLGARKPGSWT GEAAVCADSAPAARAPQALA RASGRGGRVARRGAEESGPP HSPSRRGSASRAGPGRASET M in isoform L-VEGF165, isoform L-VEGF121, isoform L-VEGF189, isoform L-VEGF206, isoform 15, isoform 16, isoform 17 and isoform 18. 1 Publication1
Alternative sequenceiVSP_026781132 – 226Missing in isoform VEGF111 and isoform 18. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_054111141 – 182KKSVR…LPGPH → N in isoform 15 and isoform 17. CuratedAdd BLAST42
Alternative sequenceiVSP_004618141K → N in isoform VEGF148, isoform VEGF165, isoform VEGF165B and isoform L-VEGF165. 10 Publications1
Alternative sequenceiVSP_004620142 – 226Missing in isoform VEGF121 and isoform L-VEGF121. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_004619142 – 182Missing in isoform VEGF148, isoform VEGF165, isoform VEGF165B and isoform L-VEGF165. 10 PublicationsAdd BLAST41
Alternative sequenceiVSP_004621160 – 182Missing in isoform VEGF183 and isoform 16. 2 PublicationsAdd BLAST23
Alternative sequenceiVSP_004623166 – 226Missing in isoform VEGF145. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_004622166 – 182Missing in isoform VEGF189 and isoform L-VEGF189. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_004624215A → M in isoform VEGF148 and isoform 17. 1 Publication1
Alternative sequenceiVSP_004625216 – 232Missing in isoform VEGF148 and isoform 17. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_014783227 – 232CDKPRR → SLTRKD in isoform VEGF165B and isoform 15. 1 Publication6

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M32977 mRNA Translation: AAA35789.1
M27281 mRNA Translation: AAA36807.1
M63978 M63977 Genomic DNA Translation: AAA36804.1
S85192 mRNA Translation: AAC63102.1 Different initiation.
AH006909 Genomic DNA Translation: AAC63101.1
X62568 mRNA Translation: CAA44447.1
AJ010438 mRNA Translation: CAA09179.1
AF022375 mRNA Translation: AAC63143.1 Sequence problems.
AF091352 mRNA Translation: AAD55345.1
AF430806 mRNA Translation: AAL27435.1
AB021221 mRNA Translation: BAA78418.1
AF214570 mRNA Translation: AAF19659.1
AY047581 mRNA Translation: AAK95847.1
AF486837 mRNA Translation: AAM03108.1
AY766116 mRNA Translation: AAV34601.1
DQ229900 mRNA Translation: ABB58912.1
AB451322 mRNA Translation: BAG70136.1
AB451451 mRNA Translation: BAG70265.1
AL136131 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX04229.1
BC065522 mRNA Translation: AAH65522.2
AF437895 Genomic DNA Translation: AAL27630.1
AF062645 mRNA Translation: AAC16730.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS34457.1 [P15692-14]
CCDS34458.1 [P15692-11]
CCDS47432.1 [P15692-15]
CCDS47433.1 [P15692-16]
CCDS47434.1 [P15692-12]
CCDS47435.1 [P15692-17]
CCDS4907.2 [P15692-13]
CCDS55007.1 [P15692-18]
CCDS55008.1 [P15692-3]
CCDS55009.1 [P15692-2]
CCDS55010.1 [P15692-1]
CCDS55011.1 [P15692-5]
CCDS55012.1 [P15692-4]
CCDS55013.1 [P15692-8]
CCDS55014.1 [P15692-9]
CCDS55015.1 [P15692-10]

Protein sequence database of the Protein Information Resource

More...PIRi		A41551

NCBI Reference Sequences

More...RefSeqi		NP_001020537.2, NM_001025366.2 [P15692-14]
NP_001020538.2, NM_001025367.2 [P15692-16]
NP_001020539.2, NM_001025368.2 [P15692-11]
NP_001020540.2, NM_001025369.2 [P15692-17]
NP_001020541.2, NM_001025370.2 [P15692-12]
NP_001028928.1, NM_001033756.2 [P15692-15]
NP_001165093.1, NM_001171622.1 [P15692-18]
NP_001165094.1, NM_001171623.1 [P15692-1]
NP_001165095.1, NM_001171624.1 [P15692-2]
NP_001165096.1, NM_001171625.1 [P15692-3]
NP_001165097.1, NM_001171626.1 [P15692-4]
NP_001165098.1, NM_001171627.1 [P15692-5]
NP_001165099.1, NM_001171628.1 [P15692-9]
NP_001165100.1, NM_001171629.1 [P15692-8]
NP_001165101.1, NM_001171630.1 [P15692-10]
NP_001191313.1, NM_001204384.1 [P15692-6]
NP_001191314.1, NM_001204385.1
NP_001273973.1, NM_001287044.1
NP_001303939.1, NM_001317010.1
NP_003367.4, NM_003376.5 [P15692-13]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000324450.11; ENSP00000317598.7; ENSG00000112715.26 [P15692-18]
ENST00000372055.9; ENSP00000361125.5; ENSG00000112715.26 [P15692-14]
ENST00000372064.9; ENSP00000361134.5; ENSG00000112715.26 [P15692-12]
ENST00000372067.8; ENSP00000361137.4; ENSG00000112715.26 [P15692-11]
ENST00000372077.8; ENSP00000361148.4; ENSG00000112715.26 [P15692-9]
ENST00000413642.8; ENSP00000389864.4; ENSG00000112715.26 [P15692-16]
ENST00000417285.7; ENSP00000388663.3; ENSG00000112715.26 [P15692-17]
ENST00000457104.6; ENSP00000409911.2; ENSG00000112715.26 [P15692-10]
ENST00000482630.7; ENSP00000421561.2; ENSG00000112715.26 [P15692-15]
ENST00000518689.5; ENSP00000430829.1; ENSG00000112715.26 [P15692-3]
ENST00000518824.5; ENSP00000430002.1; ENSG00000112715.26 [P15692-8]
ENST00000520948.5; ENSP00000428321.1; ENSG00000112715.26 [P15692-2]
ENST00000523125.5; ENSP00000429008.1; ENSG00000112715.26 [P15692-5]
ENST00000523873.5; ENSP00000430479.1; ENSG00000112715.26
ENST00000523950.5; ENSP00000429643.1; ENSG00000112715.26 [P15692-4]
ENST00000672860.3; ENSP00000500082.3; ENSG00000112715.26 [P15692-13]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7422

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7422

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000672860.3; ENSP00000500082.3; NM_003376.6; NP_003367.4 [P15692-13]

UCSC genome browser

More...UCSCi		uc003owd.5, human [P15692-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

VEGF entry

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M32977 mRNA Translation: AAA35789.1
M27281 mRNA Translation: AAA36807.1
M63978 M63977 Genomic DNA Translation: AAA36804.1
S85192 mRNA Translation: AAC63102.1 Different initiation.
AH006909 Genomic DNA Translation: AAC63101.1
X62568 mRNA Translation: CAA44447.1
AJ010438 mRNA Translation: CAA09179.1
AF022375 mRNA Translation: AAC63143.1 Sequence problems.
AF091352 mRNA Translation: AAD55345.1
AF430806 mRNA Translation: AAL27435.1
AB021221 mRNA Translation: BAA78418.1
AF214570 mRNA Translation: AAF19659.1
AY047581 mRNA Translation: AAK95847.1
AF486837 mRNA Translation: AAM03108.1
AY766116 mRNA Translation: AAV34601.1
DQ229900 mRNA Translation: ABB58912.1
AB451322 mRNA Translation: BAG70136.1
AB451451 mRNA Translation: BAG70265.1
AL136131 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX04229.1
BC065522 mRNA Translation: AAH65522.2
AF437895 Genomic DNA Translation: AAL27630.1
AF062645 mRNA Translation: AAC16730.1
CCDSiCCDS34457.1 [P15692-14]
CCDS34458.1 [P15692-11]
CCDS47432.1 [P15692-15]
CCDS47433.1 [P15692-16]
CCDS47434.1 [P15692-12]
CCDS47435.1 [P15692-17]
CCDS4907.2 [P15692-13]
CCDS55007.1 [P15692-18]
CCDS55008.1 [P15692-3]
CCDS55009.1 [P15692-2]
CCDS55010.1 [P15692-1]
CCDS55011.1 [P15692-5]
CCDS55012.1 [P15692-4]
CCDS55013.1 [P15692-8]
CCDS55014.1 [P15692-9]
CCDS55015.1 [P15692-10]
PIRiA41551
RefSeqiNP_001020537.2, NM_001025366.2 [P15692-14]
NP_001020538.2, NM_001025367.2 [P15692-16]
NP_001020539.2, NM_001025368.2 [P15692-11]
NP_001020540.2, NM_001025369.2 [P15692-17]
NP_001020541.2, NM_001025370.2 [P15692-12]
NP_001028928.1, NM_001033756.2 [P15692-15]
NP_001165093.1, NM_001171622.1 [P15692-18]
NP_001165094.1, NM_001171623.1 [P15692-1]
NP_001165095.1, NM_001171624.1 [P15692-2]
NP_001165096.1, NM_001171625.1 [P15692-3]
NP_001165097.1, NM_001171626.1 [P15692-4]
NP_001165098.1, NM_001171627.1 [P15692-5]
NP_001165099.1, NM_001171628.1 [P15692-9]
NP_001165100.1, NM_001171629.1 [P15692-8]
NP_001165101.1, NM_001171630.1 [P15692-10]
NP_001191313.1, NM_001204384.1 [P15692-6]
NP_001191314.1, NM_001204385.1
NP_001273973.1, NM_001287044.1
NP_001303939.1, NM_001317010.1
NP_003367.4, NM_003376.5 [P15692-13]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1BJ1X-ray2.40V/W34-135[»]
1CZ8X-ray2.40V/W40-133[»]
1FLTX-ray1.70V/W38-135[»]
1KATNMR-V/W37-135[»]
1KMXNMR-A183-232[»]
1MJVX-ray2.10A/B40-134[»]
1MKGX-ray2.50A/B/C/D40-134[»]
1MKKX-ray1.32A/B40-134[»]
1QTYX-ray2.70R/S/V/W34-135[»]
1TZHX-ray2.60V/W34-135[»]
1TZIX-ray2.80V34-135[»]
1VGHNMR-A180-232[»]
1VPFX-ray2.50A/B/C/D34-135[»]
1VPPX-ray1.90V/W34-135[»]
2FJGX-ray2.80V/W34-135[»]
2FJHX-ray3.10V/W34-135[»]
2QR0X-ray3.50C/D/I/J/O/P/U/V39-135[»]
2VGHNMR-A182-232[»]
2VPFX-ray1.93A/B/C/D/E/F/G/H34-135[»]
3BDYX-ray2.60V34-135[»]
3P9WX-ray2.41A/C/E/G35-138[»]
3QTKX-ray1.85A/B/C/D/E/F34-135[»]
3S1BX-ray2.90V38-133[»]
3S1KX-ray2.55V/W34-135[»]
3V2AX-ray3.20A27-140[»]
4DEQX-ray2.65A/B183-232[»]
4GLNX-ray1.60E/F34-135[»]
4GLSX-ray1.60E/F34-135[»]
4KZNX-ray1.71A39-135[»]
4QAFX-ray1.80C/D34-135[»]
4WPBX-ray3.11A/B34-135[»]
4ZFFX-ray2.75C/D37-135[»]
5DN2X-ray1.95E/F/G205-232[»]
5FV1X-ray2.70V/W27-136[»]
5FV2X-ray3.45V/W/X27-136[»]
5HHCX-ray2.10A/B34-135[»]
5HHDX-ray2.10A/B34-135[»]
5O4EX-ray2.15E/F39-134[»]
5T89X-ray4.00V/W27-155[»]
6BFTX-ray2.55C/G36-135[»]
6D3OX-ray3.10A/B34-135[»]
6T9DX-ray2.90CCC/DDD27-141[»]
6V7KX-ray2.50A/B34-135[»]
6Z13X-ray1.80V/W39-133[»]
6Z3FX-ray2.10V/W39-133[»]
6ZBRX-ray1.60V/W39-133[»]
6ZCDX-ray1.80V/W39-133[»]
6ZFLX-ray1.60V/W39-133[»]
7KEZX-ray2.31V27-136[»]
7KF0X-ray2.32C/V27-136[»]
7KF1X-ray2.45C/F/J/V27-136[»]
7LL8X-ray2.31A/B34-135[»]
7LL9X-ray2.90A/B/E/F34-135[»]
AlphaFoldDBiP15692
BMRBiP15692
SMRiP15692
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi113265, 62 interactors
ComplexPortaliCPX-1977, Vascular endothelial growth factor A complex
CORUMiP15692
DIPiDIP-5740N
IntActiP15692, 24 interactors
MINTiP15692
STRINGi9606.ENSP00000478570

Chemistry databases

BindingDBiP15692
ChEMBLiCHEMBL1783
DrugBankiDB05434, ABT-510
DB08885, Aflibercept
DB00112, Bevacizumab
DB06642, Bevasiranib
DB14864, Brolucizumab
DB01136, Carvedilol
DB09301, Chondroitin sulfate
DB06779, Dalteparin
DB05932, Denibulin
DB15303, Faricimab
DB10772, Foreskin keratinocyte (neonatal)
DB01120, Gliclazide
DB01017, Minocycline
DB04895, Pegaptanib
DB03088, Pidolic acid
DB01270, Ranibizumab
DB05969, SNS-032
DB05294, Vandetanib
DB05890, Veglin
DrugCentraliP15692

Protein family/group databases

MoonDBiP15692, Predicted

PTM databases

GlyGeniP15692, 1 site
iPTMnetiP15692
PhosphoSitePlusiP15692

Genetic variation databases

BioMutaiVEGFA
DMDMi17380528

Proteomic databases

jPOSTiP15692
MassIVEiP15692
PaxDbiP15692
PeptideAtlasiP15692
PRIDEiP15692
ProteomicsDBi34350
34645
34652
34682
35749
40743
53195 [P15692-1]
53196 [P15692-10]
53197 [P15692-11]
53198 [P15692-12]
53199 [P15692-13]
53200 [P15692-14]
53201 [P15692-2]
53202 [P15692-3]
53203 [P15692-4]
53204 [P15692-5]
53205 [P15692-6]
53206 [P15692-8]
53207 [P15692-9]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		P15692, 25 sequenced antibodies

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3956, 2774 antibodies from 55 providers

The CPTC Antibody Portal

More...CPTCi		P15692, 1 antibody

The DNASU plasmid repository

More...DNASUi		7422

Genome annotation databases

EnsembliENST00000324450.11; ENSP00000317598.7; ENSG00000112715.26 [P15692-18]
ENST00000372055.9; ENSP00000361125.5; ENSG00000112715.26 [P15692-14]
ENST00000372064.9; ENSP00000361134.5; ENSG00000112715.26 [P15692-12]
ENST00000372067.8; ENSP00000361137.4; ENSG00000112715.26 [P15692-11]
ENST00000372077.8; ENSP00000361148.4; ENSG00000112715.26 [P15692-9]
ENST00000413642.8; ENSP00000389864.4; ENSG00000112715.26 [P15692-16]
ENST00000417285.7; ENSP00000388663.3; ENSG00000112715.26 [P15692-17]
ENST00000457104.6; ENSP00000409911.2; ENSG00000112715.26 [P15692-10]
ENST00000482630.7; ENSP00000421561.2; ENSG00000112715.26 [P15692-15]
ENST00000518689.5; ENSP00000430829.1; ENSG00000112715.26 [P15692-3]
ENST00000518824.5; ENSP00000430002.1; ENSG00000112715.26 [P15692-8]
ENST00000520948.5; ENSP00000428321.1; ENSG00000112715.26 [P15692-2]
ENST00000523125.5; ENSP00000429008.1; ENSG00000112715.26 [P15692-5]
ENST00000523873.5; ENSP00000430479.1; ENSG00000112715.26
ENST00000523950.5; ENSP00000429643.1; ENSG00000112715.26 [P15692-4]
ENST00000672860.3; ENSP00000500082.3; ENSG00000112715.26 [P15692-13]
GeneIDi7422
KEGGihsa:7422
MANE-SelectiENST00000672860.3; ENSP00000500082.3; NM_003376.6; NP_003367.4 [P15692-13]
UCSCiuc003owd.5, human [P15692-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7422
DisGeNETi7422

GeneCards: human genes, protein and diseases

More...GeneCardsi		VEGFA
HGNCiHGNC:12680, VEGFA
HPAiENSG00000112715, Low tissue specificity
MalaCardsiVEGFA
MIMi192240, gene
603933, phenotype
neXtProtiNX_P15692
OpenTargetsiENSG00000112715
PharmGKBiPA37302
VEuPathDBiHostDB:ENSG00000112715

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QVI8, Eukaryota
GeneTreeiENSGT00940000157284
HOGENOMiCLU_042996_3_0_1
InParanoidiP15692
OMAiNCAERRK
PhylomeDBiP15692

Enzyme and pathway databases

PathwayCommonsiP15692
ReactomeiR-HSA-114608, Platelet degranulation
R-HSA-1234158, Regulation of gene expression by Hypoxia-inducible Factor
R-HSA-194138, Signaling by VEGF
R-HSA-194313, VEGF ligand-receptor interactions
R-HSA-195399, VEGF binds to VEGFR leading to receptor dimerization
R-HSA-4420097, VEGFA-VEGFR2 Pathway [P15692-4]
R-HSA-5218921, VEGFR2 mediated cell proliferation [P15692-4]
R-HSA-6785807, Interleukin-4 and Interleukin-13 signaling
R-HSA-8866910, TFAP2 (AP-2) family regulates transcription of growth factors and their receptors
R-HSA-9679191, Potential therapeutics for SARS [P15692-4]
SignaLinkiP15692
SIGNORiP15692

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		7422, 13 hits in 1082 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		VEGFA, human
EvolutionaryTraceiP15692

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Vascular_endothelial_growth_factor_A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7422
PharosiP15692, Tclin

Protein Ontology

More...PROi		PR:P15692
RNActiP15692, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000112715, Expressed in left lobe of thyroid gland and 240 other tissues
ExpressionAtlasiP15692, baseline and differential
GenevisibleiP15692, HS

Family and domain databases

CDDicd00135, PDGF, 1 hit
Gene3Di2.10.160.10, 1 hit
2.10.90.10, 1 hit
InterProiView protein in InterPro
IPR029034, Cystine-knot_cytokine
IPR023581, PD_growth_factor_CS
IPR000072, PDGF/VEGF_dom
IPR027928, VEGF_C
IPR036841, VEGF_C_sf
PfamiView protein in Pfam
PF00341, PDGF, 1 hit
PF14554, VEGF_C, 1 hit
SMARTiView protein in SMART
SM00141, PDGF, 1 hit
SUPFAMiSSF57501, SSF57501, 1 hit
SSF57593, SSF57593, 1 hit
PROSITEiView protein in PROSITE
PS00249, PDGF_1, 1 hit
PS50278, PDGF_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVEGFA_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P15692
Secondary accession number(s): B5BU86
, H0Y2S8, H0Y407, H0Y414, H0Y462, H0Y8N2, H3BLW7, O60720, O75875, Q074Z4, Q16889, Q5UB46, Q6P0P5, Q96KJ0, Q96L82, Q96NW5, Q9H1W8, Q9H1W9, Q9UH58, Q9UL23
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: November 16, 2001
Last modified: May 25, 2022
This is version 258 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again