Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 208 (13 Feb 2019)
Sequence version 4 (25 Nov 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Cyclic AMP-dependent transcription factor ATF-2

Gene

ATF2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional activator which regulates the transcription of various genes, including those involved in anti-apoptosis, cell growth, and DNA damage response. Dependent on its binding partner, binds to CRE (cAMP response element) consensus sequences (5'-TGACGTCA-3') or to AP-1 (activator protein 1) consensus sequences (5'-TGACTCA-3'). In the nucleus, contributes to global transcription and the DNA damage response, in addition to specific transcriptional activities that are related to cell development, proliferation and death. In the cytoplasm, interacts with and perturbs HK1- and VDAC1-containing complexes at the mitochondrial outer membrane, thereby impairing mitochondrial membrane potential, inducing mitochondrial leakage and promoting cell death. The phosphorylated form (mediated by ATM) plays a role in the DNA damage response and is involved in the ionizing radiation (IR)-induced S phase checkpoint control and in the recruitment of the MRN complex into the IR-induced foci (IRIF). Exhibits histone acetyltransferase (HAT) activity which specifically acetylates histones H2B and H4 in vitro. In concert with CUL3 and RBX1, promotes the degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM. Can elicit oncogenic or tumor suppressor activities depending on the tissue or cell type.4 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri25 – 49C2H2-typePROSITE-ProRule annotationAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding, Transferase
Biological processDNA damage, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2151201 Transcriptional activation of mitochondrial biogenesis
R-HSA-3214847 HATs acetylate histones
R-HSA-400253 Circadian Clock
R-HSA-450341 Activation of the AP-1 family of transcription factors
R-HSA-6796648 TP53 Regulates Transcription of DNA Repair Genes
R-HSA-8943724 Regulation of PTEN gene transcription
R-HSA-9018519 Estrogen-dependent gene expression

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P15336

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P15336

Protein family/group databases

MoonProt database of moonlighting proteins

More...
MoonProti
P15336

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cyclic AMP-dependent transcription factor ATF-2 (EC:2.3.1.481 Publication)
Short name:
cAMP-dependent transcription factor ATF-2
Alternative name(s):
Activating transcription factor 2
Cyclic AMP-responsive element-binding protein 2
Short name:
CREB-2
Short name:
cAMP-responsive element-binding protein 2
HB16
Histone acetyltransferase ATF2
cAMP response element-binding protein CRE-BP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ATF2
Synonyms:CREB2, CREBP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000115966.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:784 ATF2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
123811 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P15336

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane, Mitochondrion, Mitochondrion outer membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi69T → A: Weak histone acetyltransferase activity. 1 Publication1
Mutagenesisi71T → A: Impairs phosphorylation by PLK3. Weak histone acetyltransferase activity. 2 Publications1
Mutagenesisi121S → A: Reduced phosphorylation and repression of c-Jun-mediated activation of transcription. 1

Organism-specific databases

DisGeNET

More...
DisGeNETi
1386

Open Targets

More...
OpenTargetsi
ENSG00000115966

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25084

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB00852 Pseudoephedrine

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ATF2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
215274241

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000765771 – 505Cyclic AMP-dependent transcription factor ATF-2Add BLAST505

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei52Phosphothreonine; by PKC/PRKCH1 Publication1
Modified residuei62Phosphoserine; by VRK1Combined sources1 Publication1
Modified residuei69Phosphothreonine; by MAPK11 and MAPK14Combined sources3 Publications1
Modified residuei71Phosphothreonine; by MAPK1, MAPK3, MAPK11, MAPK12, MAPK14 and PLK3Combined sources4 Publications1
Modified residuei73Phosphothreonine; by VRK11 Publication1
Modified residuei90PhosphoserineCombined sources1
Modified residuei112PhosphoserineCombined sources1
Modified residuei116PhosphothreonineCombined sources1
Modified residuei121Phosphoserine; by PKC/PRKCA and PKC/PRKCB1 Publication1
Modified residuei136PhosphoserineCombined sources1
Modified residuei328PhosphoserineCombined sources1
Modified residuei340Phosphoserine; by PKC/PRKCA and PKC/PRKCB1 Publication1
Modified residuei357N6-acetyllysine1 Publication1
Modified residuei367Phosphoserine; by PKC/PRKCA and PKC/PRKCB1 Publication1
Modified residuei374N6-acetyllysine1 Publication1
Modified residuei442PhosphoserineCombined sources1
Modified residuei446PhosphoserineCombined sources1
Modified residuei490Phosphoserine; by ATM1 Publication1
Modified residuei498Phosphoserine; by ATM1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation of Thr-69 by MAPK14 and MAPK11, and at Thr-71 by MAPK1/ERK2, MAPK3/ERK1, MAPK11, MAPK12 and MAPK14 in response to external stimulus like insulin causes increased transcriptional activity. Phosphorylated by PLK3 following hyperosmotic stress. Also phosphorylated and activated by JNK and CaMK4. ATM-mediated phosphorylation at Ser-490 and Ser-498 stimulates its function in DNA damage response. Phosphorylation at Ser-62, Thr-73 and Ser-121 activates its transcriptional activity. Phosphorylation at Thr-69 or Thr-71 enhances its histone acetyltransferase (HAT) activity.9 Publications

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P15336

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P15336

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P15336

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P15336

PeptideAtlas

More...
PeptideAtlasi
P15336

PRoteomics IDEntifications database

More...
PRIDEi
P15336

ProteomicsDB human proteome resource

More...
ProteomicsDBi
53131
53132 [P15336-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P15336

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P15336

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed, with more abundant expression in the brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000115966 Expressed in 235 organ(s), highest expression level in endothelial cell

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P15336 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P15336 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB003769
HPA022134

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds DNA as a dimer and can form a homodimer in the absence of DNA. Can form a heterodimer with JUN. Heterodimerization is essential for its transcriptional activity. Interacts with SMAD3 and SMAD4. Binds through its N-terminal region to UTF1 which acts as a coactivator of ATF2 transcriptional activity. Interacts with the HK1/VDAC1 complex. Interacts with NBN, MRE11, XPO1, KAT5 and CUL3.5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107776, 215 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P15336

Database of interacting proteins

More...
DIPi
DIP-632N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P15336

Protein interaction database and analysis system

More...
IntActi
P15336, 210 interactors

Molecular INTeraction database

More...
MINTi
P15336

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000264110

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1505
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1BHINMR-A19-56[»]
1T2KX-ray3.00D354-414[»]
4H36X-ray3.00B48-55[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P15336

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P15336

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P15336

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini352 – 415bZIPPROSITE-ProRule annotationAdd BLAST64

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni296 – 299Essential for its histone acetyltransferase activity4
Regioni354 – 374Basic motifPROSITE-ProRule annotationAdd BLAST21
Regioni380 – 408Leucine-zipperPROSITE-ProRule annotationAdd BLAST29

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1 – 7Nuclear export signal 1 (N-NES)7
Motifi405 – 414Nuclear export signal 2 (C-NES)10

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The nuclear export signal 1 (N-NES) negatively regulates its nuclear localization and transcriptional activity.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the bZIP family. ATF subfamily.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri25 – 49C2H2-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1414 Eukaryota
ENOG4111CH5 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156582

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000220894

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG004300

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P15336

KEGG Orthology (KO)

More...
KOi
K04450

Identification of Orthologs from Complete Genome Data

More...
OMAi
HPEAIQH

Database of Orthologous Groups

More...
OrthoDBi
1472201at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P15336

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029836 ATF2
IPR004827 bZIP
IPR016378 TF_CRE-BP1-typ
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

The PANTHER Classification System

More...
PANTHERi
PTHR19304:SF9 PTHR19304:SF9, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00170 bZIP_1, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF003153 ATF2_CRE-BP1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00338 BRLZ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50217 BZIP, 1 hit
PS00036 BZIP_BASIC, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 1 hit
PS50157 ZINC_FINGER_C2H2_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P15336-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKFKLHVNSA RQYKDLWNMS DDKPFLCTAP GCGQRFTNED HLAVHKHKHE
60 70 80 90 100
MTLKFGPARN DSVIVADQTP TPTRFLKNCE EVGLFNELAS PFENEFKKAS
110 120 130 140 150
EDDIKKMPLD LSPLATPIIR SKIEEPSVVE TTHQDSPLPH PESTTSDEKE
160 170 180 190 200
VPLAQTAQPT SAIVRPASLQ VPNVLLTSSD SSVIIQQAVP SPTSSTVITQ
210 220 230 240 250
APSSNRPIVP VPGPFPLLLH LPNGQTMPVA IPASITSSNV HVPAAVPLVR
260 270 280 290 300
PVTMVPSVPG IPGPSSPQPV QSEAKMRLKA ALTQQHPPVT NGDTVKGHGS
310 320 330 340 350
GLVRTQSEES RPQSLQQPAT STTETPASPA HTTPQTQSTS GRRRRAANED
360 370 380 390 400
PDEKRRKFLE RNRAAASRCR QKRKVWVQSL EKKAEDLSSL NGQLQSEVTL
410 420 430 440 450
LRNEVAQLKQ LLLAHKDCPV TAMQKKSGYH TADKDDSSED ISVPSSPHTE
460 470 480 490 500
AIQHSSVSTS NGVSSTSKAE AVATSVLTQM ADQSTEPALS QIVMAPSSQS

QPSGS
Length:505
Mass (Da):54,537
Last modified:November 25, 2008 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0190EEFAEC8891A7
GO
Isoform 2 (identifier: P15336-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-176: Missing.
     177-185: TSSDSSVII → MSTAYFQMM

Show »
Length:329
Mass (Da):35,044
Checksum:iFA37EF544698FEFA
GO
Isoform 3 (identifier: P15336-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     210-505: Missing.

Show »
Length:209
Mass (Da):23,050
Checksum:iA26AF07CA5D8D5E7
GO
Isoform 4 (identifier: P15336-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVA → MYCAWMWP

Show »
Length:447
Mass (Da):48,013
Checksum:i344628FF8F94AAED
GO
Isoform 5 (identifier: P15336-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: Missing.

Show »
Length:487
Mass (Da):52,277
Checksum:i58ADD6240D6270E8
GO
Isoform 6 (identifier: P15336-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: Missing.
     34-394: Missing.

Show »
Length:126
Mass (Da):13,149
Checksum:iB9D2E843EB156412
GO
Isoform 7 (identifier: P15336-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: Missing.
     210-237: PVPGPFPLLLHLPNGQTMPVAIPASITS → SFDQSPWCLVFQESQVLPLPNQYSQKQK
     238-505: Missing.

Show »
Length:219
Mass (Da):24,097
Checksum:i6DA3C87FF1008F68
GO
Isoform 8 (identifier: P15336-8) [UniParc]FASTAAdd to basket
Also known as: ATF2-small

The sequence of this isoform differs from the canonical sequence as follows:
     34-394: Missing.

Show »
Length:144
Mass (Da):15,409
Checksum:i8B7F060B955355C7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B8ZZU6B8ZZU6_HUMAN
Cyclic AMP-dependent transcription ...
ATF2
389Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H629F5H629_HUMAN
Cyclic AMP-dependent transcription ...
ATF2
329Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C2N6H7C2N6_HUMAN
Cyclic AMP-dependent transcription ...
ATF2
265Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PBF9E9PBF9_HUMAN
Cyclic AMP-dependent transcription ...
ATF2
395Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PEK8E9PEK8_HUMAN
Cyclic AMP-dependent transcription ...
ATF2
237Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JCI8C9JCI8_HUMAN
Cyclic AMP-dependent transcription ...
ATF2
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z2K2F2Z2K2_HUMAN
Cyclic AMP-dependent transcription ...
ATF2
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAY17203 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAY17207 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti209V → L in AAB64017 (PubMed:9058782).Curated1
Sequence conflicti223N → S in CAA33886 (PubMed:2529117).Curated1
Sequence conflicti223N → S in AAY17203 (Ref. 4) Curated1
Sequence conflicti223N → S in AAY17207 (Ref. 4) Curated1
Sequence conflicti223N → S in AAY17215 (Ref. 4) Curated1
Sequence conflicti311R → L in AAB64017 (PubMed:9058782).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_035999352D → H in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0005871 – 176Missing in isoform 2. 1 PublicationAdd BLAST176
Alternative sequenceiVSP_0469591 – 66MKFKL…SVIVA → MYCAWMWP in isoform 4. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_0469601 – 18Missing in isoform 5, isoform 6 and isoform 7. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_04759334 – 394Missing in isoform 6 and isoform 8. 2 PublicationsAdd BLAST361
Alternative sequenceiVSP_000588177 – 185TSSDSSVII → MSTAYFQMM in isoform 2. 1 Publication9
Alternative sequenceiVSP_045161210 – 505Missing in isoform 3. 1 PublicationAdd BLAST296
Alternative sequenceiVSP_047594210 – 237PVPGP…ASITS → SFDQSPWCLVFQESQVLPLP NQYSQKQK in isoform 7. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_047595238 – 505Missing in isoform 7. 1 PublicationAdd BLAST268

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X15875 mRNA Translation: CAA33886.1
U16028 mRNA Translation: AAB64017.1
AY029364 mRNA Translation: AAK55760.1
DQ003037 mRNA Translation: AAY17203.1 Different initiation.
DQ003038 mRNA Translation: AAY17204.1
DQ003041 mRNA Translation: AAY17207.1 Different initiation.
DQ003044 mRNA Translation: AAY17210.1
DQ003047 mRNA Translation: AAY17213.1
DQ003049 mRNA Translation: AAY17215.1
AC131958 Genomic DNA Translation: AAX88876.1
AC074291 Genomic DNA Translation: AAY15004.1
AC007435 Genomic DNA No translation available.
AC096649 Genomic DNA No translation available.
CH471058 Genomic DNA Translation: EAX11111.1
CH471058 Genomic DNA Translation: EAX11112.1
CH471058 Genomic DNA Translation: EAX11113.1
BC026175 mRNA Translation: AAH26175.1
BC107698 mRNA Translation: AAI07699.1
BC130335 mRNA Translation: AAI30336.1
BC130337 mRNA Translation: AAI30338.1
M31630 mRNA Translation: AAA35951.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2262.1 [P15336-1]
CCDS58737.1 [P15336-4]
CCDS58738.1 [P15336-5]
CCDS58739.1 [P15336-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
S05380

NCBI Reference Sequences

More...
RefSeqi
NP_001243019.1, NM_001256090.1 [P15336-1]
NP_001243020.1, NM_001256091.1 [P15336-5]
NP_001243021.1, NM_001256092.1 [P15336-4]
NP_001243022.1, NM_001256093.1
NP_001243023.1, NM_001256094.1 [P15336-3]
NP_001871.2, NM_001880.3 [P15336-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.592510

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000264110; ENSP00000264110; ENSG00000115966 [P15336-1]
ENST00000345739; ENSP00000340576; ENSG00000115966 [P15336-4]
ENST00000392544; ENSP00000376327; ENSG00000115966 [P15336-1]
ENST00000409499; ENSP00000386282; ENSG00000115966 [P15336-8]
ENST00000409635; ENSP00000387093; ENSG00000115966 [P15336-4]
ENST00000409833; ENSP00000386526; ENSG00000115966 [P15336-3]
ENST00000426833; ENSP00000407911; ENSG00000115966 [P15336-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1386

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1386

UCSC genome browser

More...
UCSCi
uc002ujk.5 human [P15336-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X15875 mRNA Translation: CAA33886.1
U16028 mRNA Translation: AAB64017.1
AY029364 mRNA Translation: AAK55760.1
DQ003037 mRNA Translation: AAY17203.1 Different initiation.
DQ003038 mRNA Translation: AAY17204.1
DQ003041 mRNA Translation: AAY17207.1 Different initiation.
DQ003044 mRNA Translation: AAY17210.1
DQ003047 mRNA Translation: AAY17213.1
DQ003049 mRNA Translation: AAY17215.1
AC131958 Genomic DNA Translation: AAX88876.1
AC074291 Genomic DNA Translation: AAY15004.1
AC007435 Genomic DNA No translation available.
AC096649 Genomic DNA No translation available.
CH471058 Genomic DNA Translation: EAX11111.1
CH471058 Genomic DNA Translation: EAX11112.1
CH471058 Genomic DNA Translation: EAX11113.1
BC026175 mRNA Translation: AAH26175.1
BC107698 mRNA Translation: AAI07699.1
BC130335 mRNA Translation: AAI30336.1
BC130337 mRNA Translation: AAI30338.1
M31630 mRNA Translation: AAA35951.1
CCDSiCCDS2262.1 [P15336-1]
CCDS58737.1 [P15336-4]
CCDS58738.1 [P15336-5]
CCDS58739.1 [P15336-3]
PIRiS05380
RefSeqiNP_001243019.1, NM_001256090.1 [P15336-1]
NP_001243020.1, NM_001256091.1 [P15336-5]
NP_001243021.1, NM_001256092.1 [P15336-4]
NP_001243022.1, NM_001256093.1
NP_001243023.1, NM_001256094.1 [P15336-3]
NP_001871.2, NM_001880.3 [P15336-1]
UniGeneiHs.592510

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1BHINMR-A19-56[»]
1T2KX-ray3.00D354-414[»]
4H36X-ray3.00B48-55[»]
ProteinModelPortaliP15336
SMRiP15336
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107776, 215 interactors
CORUMiP15336
DIPiDIP-632N
ELMiP15336
IntActiP15336, 210 interactors
MINTiP15336
STRINGi9606.ENSP00000264110

Chemistry databases

DrugBankiDB00852 Pseudoephedrine

Protein family/group databases

MoonProtiP15336

PTM databases

iPTMnetiP15336
PhosphoSitePlusiP15336

Polymorphism and mutation databases

BioMutaiATF2
DMDMi215274241

Proteomic databases

EPDiP15336
jPOSTiP15336
MaxQBiP15336
PaxDbiP15336
PeptideAtlasiP15336
PRIDEiP15336
ProteomicsDBi53131
53132 [P15336-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
1386
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264110; ENSP00000264110; ENSG00000115966 [P15336-1]
ENST00000345739; ENSP00000340576; ENSG00000115966 [P15336-4]
ENST00000392544; ENSP00000376327; ENSG00000115966 [P15336-1]
ENST00000409499; ENSP00000386282; ENSG00000115966 [P15336-8]
ENST00000409635; ENSP00000387093; ENSG00000115966 [P15336-4]
ENST00000409833; ENSP00000386526; ENSG00000115966 [P15336-3]
ENST00000426833; ENSP00000407911; ENSG00000115966 [P15336-5]
GeneIDi1386
KEGGihsa:1386
UCSCiuc002ujk.5 human [P15336-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1386
DisGeNETi1386
EuPathDBiHostDB:ENSG00000115966.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ATF2
HGNCiHGNC:784 ATF2
HPAiCAB003769
HPA022134
MIMi123811 gene
neXtProtiNX_P15336
OpenTargetsiENSG00000115966
PharmGKBiPA25084

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1414 Eukaryota
ENOG4111CH5 LUCA
GeneTreeiENSGT00940000156582
HOGENOMiHOG000220894
HOVERGENiHBG004300
InParanoidiP15336
KOiK04450
OMAiHPEAIQH
OrthoDBi1472201at2759
PhylomeDBiP15336

Enzyme and pathway databases

ReactomeiR-HSA-2151201 Transcriptional activation of mitochondrial biogenesis
R-HSA-3214847 HATs acetylate histones
R-HSA-400253 Circadian Clock
R-HSA-450341 Activation of the AP-1 family of transcription factors
R-HSA-6796648 TP53 Regulates Transcription of DNA Repair Genes
R-HSA-8943724 Regulation of PTEN gene transcription
R-HSA-9018519 Estrogen-dependent gene expression
SignaLinkiP15336
SIGNORiP15336

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ATF2 human
EvolutionaryTraceiP15336

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Activating_transcription_factor_2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1386

Protein Ontology

More...
PROi
PR:P15336

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000115966 Expressed in 235 organ(s), highest expression level in endothelial cell
ExpressionAtlasiP15336 baseline and differential
GenevisibleiP15336 HS

Family and domain databases

InterProiView protein in InterPro
IPR029836 ATF2
IPR004827 bZIP
IPR016378 TF_CRE-BP1-typ
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PANTHERiPTHR19304:SF9 PTHR19304:SF9, 1 hit
PfamiView protein in Pfam
PF00170 bZIP_1, 1 hit
PIRSFiPIRSF003153 ATF2_CRE-BP1, 1 hit
SMARTiView protein in SMART
SM00338 BRLZ, 1 hit
SUPFAMiSSF57667 SSF57667, 1 hit
PROSITEiView protein in PROSITE
PS50217 BZIP, 1 hit
PS00036 BZIP_BASIC, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 1 hit
PS50157 ZINC_FINGER_C2H2_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiATF2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P15336
Secondary accession number(s): A1L3Z2
, A4D7U4, A4D7U5, A4D7V1, D3DPE9, G8JLM5, Q13000, Q3B7B7, Q4ZFU9, Q53RY2, Q8TAR1, Q96JT8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: November 25, 2008
Last modified: February 13, 2019
This is version 208 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again