Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peripherin

Gene

Prph

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Class-III neuronal intermediate filament protein.

GO - Molecular functioni

GO - Biological processi

  • intermediate filament cytoskeleton organization Source: MGI

Names & Taxonomyi

Protein namesi
Recommended name:
Peripherin
Gene namesi
Name:Prph
Synonyms:Prph1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:97774 Prph

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Intermediate filament

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000637801 – 475PeripherinAdd BLAST475

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei24Nitrated tyrosineBy similarity1
Modified residuei35PhosphoserineBy similarity1
Modified residuei57PhosphoserineBy similarity1
Modified residuei383Nitrated tyrosineBy similarity1
Modified residuei475PhosphotyrosineBy similarity1

Keywords - PTMi

Nitration, Phosphoprotein

Proteomic databases

MaxQBiP15331
PRIDEiP15331

2D gel databases

UCD-2DPAGEiP15331

PTM databases

iPTMnetiP15331
PhosphoSitePlusiP15331

Expressioni

Gene expression databases

CleanExiMM_PRPH

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

IntActiP15331, 10 interactors
MINTiP15331

Structurei

3D structure databases

ProteinModelPortaliP15331
SMRiP15331
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini101 – 411IF rodPROSITE-ProRule annotationAdd BLAST311

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 103HeadAdd BLAST103
Regioni104 – 136Coil 1AAdd BLAST33
Regioni137 – 147Linker 1Add BLAST11
Regioni148 – 243Coil 1BAdd BLAST96
Regioni244 – 266Linker 2Add BLAST23
Regioni267 – 409Coil 2Add BLAST143
Regioni410 – 475TailAdd BLAST66

Sequence similaritiesi

Belongs to the intermediate filament family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

HOGENOMiHOG000230977
HOVERGENiHBG013015
InParanoidiP15331
PhylomeDBiP15331

Family and domain databases

InterProiView protein in InterPro
IPR001664 IF
IPR018039 IF_conserved
IPR039008 IF_rod_dom
IPR006821 Intermed_filament_DNA-bd
IPR002957 Keratin_I
IPR027700 PRPH/Plasticin
PANTHERiPTHR23239 PTHR23239, 1 hit
PTHR23239:SF29 PTHR23239:SF29, 1 hit
PfamiView protein in Pfam
PF00038 Filament, 1 hit
PF04732 Filament_head, 1 hit
PRINTSiPR01248 TYPE1KERATIN
SMARTiView protein in SMART
SM01391 Filament, 1 hit
PROSITEiView protein in PROSITE
PS00226 IF_ROD_1, 1 hit
PS51842 IF_ROD_2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 5g (identifier: P15331-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPSSASMSHH HSSGLRSSIS STSYRRTFGP PPSLSPGAFS YSSSSRFSSS
60 70 80 90 100
RLLGSGSPSS SARLGSFRAP RAGALRLPSE RLDFSMAEAL NQEFLATRSN
110 120 130 140 150
EKQELQELND RFANFIEKVR FLEQQNAALR GELSQARGQE PARADQLCQQ
160 170 180 190 200
ELRELRRELE LLGRERDRVQ VERDGLAEDL AALKQRLEEE TRKREDAEHN
210 220 230 240 250
LVLFRKDVDD ATLSRLELER KIESLMDEIE FLKKLHEEEL RDLQVSVESQ
260 270 280 290 300
QVQQVEVEAT VKPELTAALR DIRAQYENIA AKNLQEAEEW YKSKYADLSD
310 320 330 340 350
AANRNHEALR QAKQEMNESR RQIQSLTCEV DGLRGTNEAL LRQLRELEEQ
360 370 380 390 400
FALEAGGYQA GAARLEEELR QLKEEMARHL REYQELLNVK MALDIEIATY
410 420 430 440 450
RKLLEGEESR ISVPVHSFAS LSLKTTVPEM EPLQDSHSKK MVLIRTIETR
460 470
DGEKVVTESQ KEQHSDLDKS SIHSY
Length:475
Mass (Da):54,268
Last modified:July 15, 1998 - v2
Checksum:i777300B08A312953
GO
Isoform 3u (identifier: P15331-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     294-294: K → KVREHWGNPGGPRVGRHWEWRCASQPGLSATAQ

Show »
Length:507
Mass (Da):57,834
Checksum:i17267805F7EB06B1
GO
Isoform 5b (identifier: P15331-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     454-475: KVVTESQKEQHSDLDKSSIHSY → LLRPQPEL

Show »
Length:461
Mass (Da):52,687
Checksum:i933A0F49FF99D55C
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3X981G3X981_MOUSE
Peripherin
Prph Prph1, mCG_18385
507Annotation score:
G5E846G5E846_MOUSE
Peripherin
Prph Prph1, mCG_18385
475Annotation score:
A0A2R8W6R6A0A2R8W6R6_MOUSE
Peripherin
Prph
506Annotation score:
A0A2R8VKR9A0A2R8VKR9_MOUSE
Peripherin
Prph
48Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002466294K → KVREHWGNPGGPRVGRHWEW RCASQPGLSATAQ in isoform 3u. Curated1
Alternative sequenceiVSP_002467454 – 475KVVTE…SIHSY → LLRPQPEL in isoform 5b. CuratedAdd BLAST22

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X15475 mRNA Translation: CAA33502.1
BC046291 mRNA Translation: AAH46291.1
X59840 Genomic DNA Translation: CAA42499.1
X59840 Genomic DNA Translation: CAA42500.1
X59840 Genomic DNA Translation: CAA42501.1
CCDSiCCDS27813.1 [P15331-2]
CCDS49727.1 [P15331-1]
PIRiS14887
UniGeneiMm.2477

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X15475 mRNA Translation: CAA33502.1
BC046291 mRNA Translation: AAH46291.1
X59840 Genomic DNA Translation: CAA42499.1
X59840 Genomic DNA Translation: CAA42500.1
X59840 Genomic DNA Translation: CAA42501.1
CCDSiCCDS27813.1 [P15331-2]
CCDS49727.1 [P15331-1]
PIRiS14887
UniGeneiMm.2477

3D structure databases

ProteinModelPortaliP15331
SMRiP15331
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP15331, 10 interactors
MINTiP15331

PTM databases

iPTMnetiP15331
PhosphoSitePlusiP15331

2D gel databases

UCD-2DPAGEiP15331

Proteomic databases

MaxQBiP15331
PRIDEiP15331

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

MGIiMGI:97774 Prph

Phylogenomic databases

HOGENOMiHOG000230977
HOVERGENiHBG013015
InParanoidiP15331
PhylomeDBiP15331

Miscellaneous databases

PROiPR:P15331
SOURCEiSearch...

Gene expression databases

CleanExiMM_PRPH

Family and domain databases

InterProiView protein in InterPro
IPR001664 IF
IPR018039 IF_conserved
IPR039008 IF_rod_dom
IPR006821 Intermed_filament_DNA-bd
IPR002957 Keratin_I
IPR027700 PRPH/Plasticin
PANTHERiPTHR23239 PTHR23239, 1 hit
PTHR23239:SF29 PTHR23239:SF29, 1 hit
PfamiView protein in Pfam
PF00038 Filament, 1 hit
PF04732 Filament_head, 1 hit
PRINTSiPR01248 TYPE1KERATIN
SMARTiView protein in SMART
SM01391 Filament, 1 hit
PROSITEiView protein in PROSITE
PS00226 IF_ROD_1, 1 hit
PS51842 IF_ROD_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPERI_MOUSE
AccessioniPrimary (citable) accession number: P15331
Secondary accession number(s): O35688, O35689
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: July 15, 1998
Last modified: September 12, 2018
This is version 141 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again