Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 154 (07 Apr 2021)
Sequence version 2 (15 Jul 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Peripherin

Gene

Prph

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Class-III neuronal intermediate filament protein (By similarity). May form an independent structural network without the involvement of other neurofilaments or may cooperate with the neuronal intermediate filament proteins NEFL, NEFH, NEFM and INA to form filamentous networks (PubMed:22723690, PubMed:15322088, PubMed:10426285). Assembly of the neuronal intermediate filaments may be regulated by RAB7A (PubMed:23179371). Plays a role in the development of unmyelinated sensory neurons (PubMed:12065660). May be involved in axon elongation and axon regeneration after injury (By similarity). Inhibits neurite extension in type II spiral ganglion neurons in the cochlea (PubMed:20132868).By similarity6 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Peripherin
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Prph
Synonyms:Prph1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:97774, Prph

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Intermediate filament

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mutant mice are viable, reproduce normally and do not exhibit gross morphological defects (PubMed:12065660). Increased levels of intermediate filament proteins Vim in the spinal cord and Ina in L5 ventral roots, and a reduction in the number of L5 unmyelinated sensory fibers (PubMed:12065660). More and longer type II spiral ganglion neuron neurites during cochlear neuritogenesis at P1 (PubMed:20132868).2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi66S → A: Abolishes phosphorylation by AKT. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000637801 – 475PeripherinAdd BLAST475

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei243'-nitrotyrosineBy similarity1
Modified residuei35PhosphoserineBy similarity1
Modified residuei57PhosphoserineBy similarity1
Modified residuei66Phosphoserine; by PKB/AKT11 Publication1
Modified residuei3833'-nitrotyrosineBy similarity1
Modified residuei475PhosphotyrosineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated; phosphorylation increases after nerve injury in regenerating neurons.By similarity

Keywords - PTMi

Nitration, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P15331

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P15331

PRoteomics IDEntifications database

More...
PRIDEi
P15331

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
288030 [P15331-1]
288031 [P15331-2]
288032 [P15331-3]

2D gel databases

University College Dublin 2-DE Proteome Database

More...
UCD-2DPAGEi
P15331

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P15331

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P15331

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the sciatic nerve and at very low levels in the central nervous system (at protein level) (PubMed:22723690). Expressed in the spinal cord, in the sciatic nerve at the level of the dorsal root ganglion and in trigeminal nerves (at protein level) (PubMed:12065660). Expressed in the cranial nerves in the hindbrain, including the sensory and motor trigeminal neurons, the mesencephalic trigeminal neurons, the spinal trigeminal neurons, and in the facial nerve (at protein level) (PubMed:17899157). Expressed in the cerebellum, with expression in the inferior cerebellar peduncle and the lateral deep cerebellar nucleus (at protein level) (PubMed:17899157). Expressed in vestibulocochlear neurons, such as the anteroventral cochlear nucleus, the dorsal cochlear nucleus, the superficial granule cell layer and the granule cell lamina (at protein level) (PubMed:17899157). Expressed in glossopharyngeal, vagal and hypoglossal neurons (at protein level) (PubMed:17899157). Expressed in peripheral sensory neurons, in the dorsal root ganglia and the spinal cord, and to a lower extent in motor neurons (PubMed:18709437). Expressed in the optic tract of the central nervous system, especially in the lateral geniculate nucleus and the superior colliculus (PubMed:18709437). Expressed in neurons of the pineal stalk in the cortex (PubMed:18709437). Expressed in the spinal trigeminal tract of the midbrain, in the medulla and in the medial cerebellar peduncle (PubMed:18709437).4 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in the dorsal root ganglia and in the spinal cord at 9.5 dpc (PubMed:18709437). Expressed in the neurons that innervate the limb buds at 13 dpc (PubMed:18709437). Expressed in the dorsal root ganglia and the sciatic nerve at 13.5 dpc (PubMed:23179371). Expressed in type I and type II spiral ganglion neurons of the cochlea at postnatal days P1 to P7 (PubMed:20132868).3 Publications

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms homodimers (in vitro) (By similarity). Homopolymerizes into a filamentous network (in vitro) (PubMed:10426285). Forms heterodimers with NEFL, NEFM or NEFH (in vitro) (By similarity).

Interacts with DST (via C-terminus) (PubMed:9971739).

Interacts with RAB7A; the interaction is direct (PubMed:23179371).

Interacts with PRKCE (via phorbol-ester/DAG-type 2 domain) (By similarity).

By similarity3 Publications

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
P15331, 10 interactors

Molecular INTeraction database

More...
MINTi
P15331

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000049303

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P15331, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P15331

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini101 – 411IF rodPROSITE-ProRule annotationAdd BLAST311

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 103HeadAdd BLAST103
Regioni104 – 136Coil 1AAdd BLAST33
Regioni137 – 147Linker 1Add BLAST11
Regioni148 – 243Coil 1BAdd BLAST96
Regioni244 – 266Linker 2Add BLAST23
Regioni267 – 409Coil 2Add BLAST143
Regioni410 – 475TailAdd BLAST66

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the intermediate filament family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QPSH, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P15331

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P15331

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.5.1160, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR018039, IF_conserved
IPR039008, IF_rod_dom
IPR042180, IF_rod_dom_coil1B
IPR006821, Intermed_filament_DNA-bd
IPR002957, Keratin_I
IPR027700, PRPH/Plasticin

The PANTHER Classification System

More...
PANTHERi
PTHR45652:SF14, PTHR45652:SF14, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00038, Filament, 1 hit
PF04732, Filament_head, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01248, TYPE1KERATIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01391, Filament, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00226, IF_ROD_1, 1 hit
PS51842, IF_ROD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 5g (identifier: P15331-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPSSASMSHH HSSGLRSSIS STSYRRTFGP PPSLSPGAFS YSSSSRFSSS
60 70 80 90 100
RLLGSGSPSS SARLGSFRAP RAGALRLPSE RLDFSMAEAL NQEFLATRSN
110 120 130 140 150
EKQELQELND RFANFIEKVR FLEQQNAALR GELSQARGQE PARADQLCQQ
160 170 180 190 200
ELRELRRELE LLGRERDRVQ VERDGLAEDL AALKQRLEEE TRKREDAEHN
210 220 230 240 250
LVLFRKDVDD ATLSRLELER KIESLMDEIE FLKKLHEEEL RDLQVSVESQ
260 270 280 290 300
QVQQVEVEAT VKPELTAALR DIRAQYENIA AKNLQEAEEW YKSKYADLSD
310 320 330 340 350
AANRNHEALR QAKQEMNESR RQIQSLTCEV DGLRGTNEAL LRQLRELEEQ
360 370 380 390 400
FALEAGGYQA GAARLEEELR QLKEEMARHL REYQELLNVK MALDIEIATY
410 420 430 440 450
RKLLEGEESR ISVPVHSFAS LSLKTTVPEM EPLQDSHSKK MVLIRTIETR
460 470
DGEKVVTESQ KEQHSDLDKS SIHSY
Length:475
Mass (Da):54,268
Last modified:July 15, 1998 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i777300B08A312953
GO
Isoform 3u (identifier: P15331-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     294-294: K → KVREHWGNPGGPRVGRHWEWRCASQPGLSATAQ

Show »
Length:507
Mass (Da):57,834
Checksum:i17267805F7EB06B1
GO
Isoform 5b (identifier: P15331-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     454-475: KVVTESQKEQHSDLDKSSIHSY → LLRPQPEL

Show »
Length:461
Mass (Da):52,687
Checksum:i933A0F49FF99D55C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2R8W6R6A0A2R8W6R6_MOUSE
Peripherin
Prph
506Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G5E846G5E846_MOUSE
Peripherin
Prph
475Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3X981G3X981_MOUSE
Peripherin
Prph
507Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8VKR9A0A2R8VKR9_MOUSE
Peripherin
Prph
48Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_002466294K → KVREHWGNPGGPRVGRHWEW RCASQPGLSATAQ in isoform 3u. Curated1
Alternative sequenceiVSP_002467454 – 475KVVTE…SIHSY → LLRPQPEL in isoform 5b. CuratedAdd BLAST22

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X15475 mRNA Translation: CAA33502.1
BC046291 mRNA Translation: AAH46291.1
X59840 Genomic DNA Translation: CAA42499.1
X59840 Genomic DNA Translation: CAA42500.1
X59840 Genomic DNA Translation: CAA42501.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS27813.1 [P15331-2]
CCDS49727.1 [P15331-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S14887

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X15475 mRNA Translation: CAA33502.1
BC046291 mRNA Translation: AAH46291.1
X59840 Genomic DNA Translation: CAA42499.1
X59840 Genomic DNA Translation: CAA42500.1
X59840 Genomic DNA Translation: CAA42501.1
CCDSiCCDS27813.1 [P15331-2]
CCDS49727.1 [P15331-1]
PIRiS14887

3D structure databases

SMRiP15331
ModBaseiSearch...

Protein-protein interaction databases

IntActiP15331, 10 interactors
MINTiP15331
STRINGi10090.ENSMUSP00000049303

PTM databases

iPTMnetiP15331
PhosphoSitePlusiP15331

2D gel databases

UCD-2DPAGEiP15331

Proteomic databases

jPOSTiP15331
MaxQBiP15331
PRIDEiP15331
ProteomicsDBi288030 [P15331-1]
288031 [P15331-2]
288032 [P15331-3]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
P15331, 1 sequenced antibody

Organism-specific databases

MGIiMGI:97774, Prph

Phylogenomic databases

eggNOGiENOG502QPSH, Eukaryota
InParanoidiP15331
PhylomeDBiP15331

Miscellaneous databases

Protein Ontology

More...
PROi
PR:P15331
RNActiP15331, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

Gene3Di1.20.5.1160, 1 hit
InterProiView protein in InterPro
IPR018039, IF_conserved
IPR039008, IF_rod_dom
IPR042180, IF_rod_dom_coil1B
IPR006821, Intermed_filament_DNA-bd
IPR002957, Keratin_I
IPR027700, PRPH/Plasticin
PANTHERiPTHR45652:SF14, PTHR45652:SF14, 1 hit
PfamiView protein in Pfam
PF00038, Filament, 1 hit
PF04732, Filament_head, 1 hit
PRINTSiPR01248, TYPE1KERATIN
SMARTiView protein in SMART
SM01391, Filament, 1 hit
PROSITEiView protein in PROSITE
PS00226, IF_ROD_1, 1 hit
PS51842, IF_ROD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPERI_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P15331
Secondary accession number(s): O35688, O35689
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: July 15, 1998
Last modified: April 7, 2021
This is version 154 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again