UniProtKB - P15313 (VATB1_HUMAN)

BLAST

>sp|P15313|VATB1_HUMAN V-type proton ATPase subunit B, kidney isoform OS=Homo sapiens OX=9606 GN=ATP6V1B1 PE=1 SV=3
MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFA
QYAEIVHFTLPDGTQRSGQVLEVAGTKAIVQVFEGTSGIDARKTTCEFTGDILRTPVSED
MLGRVFNGSGKPIDKGPVVMAEDFLDINGQPINPHSRIYPEEMIQTGISPIDVMNSIARG
QKIPIFSAAGLPHNEIAAQICRQAGLVKKSKAVLDYHDDNFAIVFAAMGVNMETARFFKS
DFEQNGTMGNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEA
LREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRGGSITQIPILTMPNDDITHPIP
DLTGFITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYACY
AIGKDVQAMKAVVGEEALTSEDLLYLEFLQKFEKNFINQGPYENRSVFESLDLGWKLLRI
FPKEMLKRIPQAVIDEFYSREGALQDLAPDTAL

Align
Format
Add to basket Added to basket
History
Entry version 198 (07 Nov 2018)
Sequence version 3 (25 Nov 2008)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

V-type proton ATPase subunit B, kidney isoform

Gene

ATP6V1B1

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Non-catalytic subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

GO - Molecular functionⁱ

ATP binding Source: InterPro
hydrolase activity Source: UniProtKB-KW
protein-containing complex binding Source: Ensembl
proton transmembrane transporter activity
Source: UniProtKB
Inferred from sequence or structural similarityⁱ
- 14585495

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

ATP hydrolysis coupled proton transport Source: InterPro
ATP metabolic process Source: InterPro
calcium ion homeostasis
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 19478356
- 20622307
excretion
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 19478356
inner ear morphogenesis
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 19639346
insulin receptor signaling pathway Source: Reactome
ion transmembrane transport Source: Reactome
ossification
Source: HGNC
Inferred from mutant phenotypeⁱ
- 16433694
pH reduction
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 19478356
- 20622307
proton transmembrane transport
Source: HGNC
Inferred from mutant phenotypeⁱ
- 12414817
regulation of macroautophagy
Source: ParkinsonsUK-UCL
Non-traceable author statementⁱ
- 22982048
regulation of pH
Source: HGNC
Inferred from mutant phenotypeⁱ
- 12414817
sensory perception of sound
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 19478356
- 20622307
transferrin transport Source: Reactome

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Hydrolase
Biological process	Hydrogen ion transport, Ion transport, Transport

Enzyme and pathway databases

BioCycⁱ	MetaCyc:HS03975-MONOMER
Reactomeⁱ	R-HSA-1222556 ROS, RNS production in phagocytes R-HSA-77387 Insulin receptor recycling R-HSA-917977 Transferrin endocytosis and recycling R-HSA-983712 Ion channel transport

Protein family/group databases

TCDBⁱ	3.A.2.2.4 the h(+)- or na(+)-translocating f-type, v-type and a-type atpase (f-atpase) superfamily

TCDBⁱ

3.A.2.2.4 the h(+)- or na(+)-translocating f-type, v-type and a-type atpase (f-atpase) superfamily

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: V-type proton ATPase subunit B, kidney isoform Short name: V-ATPase subunit B 1 Alternative name(s): Endomembrane proton pump 58 kDa subunit Vacuolar proton pump subunit B 1
Gene namesⁱ	Name:ATP6V1B1 Synonyms:ATP6B1, VATB, VPP3
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 2

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000116039.11
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:853 ATP6V1B1
MIMⁱ	192132 gene
neXtProtⁱ	NX_P15313

Keywords - Cellular componentⁱ

Membrane

Pathology & Biotechⁱ

Involvement in diseaseⁱ

Renal tubular acidosis, distal, with progressive nerve deafness (dRTA-D)3 Publications

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionAn autosomal recessive disease characterized by the association of renal distal tubular acidosis with sensorineural hearing loss. Distal renal tubular acidosis is characterized by reduced ability to acidify urine, variable hyperchloremic hypokalemic metabolic acidosis, nephrocalcinosis, and nephrolithiasis. It is due to functional failure of alpha-intercalated cells of the cortical collecting duct of the distal nephron, where vectorial proton transport is required for urinary acidification.

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_007866	81	L → P in dRTA-D. 3 PublicationsCorresponds to variant dbSNP:rs121964880EnsemblClinVar.	1
Natural variantⁱVAR_021012	123	G → V in dRTA-D. 1 Publication	1
Natural variantⁱVAR_007867	124	R → W in dRTA-D. 1 PublicationCorresponds to variant dbSNP:rs727505222EnsemblClinVar.	1
Natural variantⁱVAR_021013	157	R → C in dRTA-D. 1 PublicationCorresponds to variant dbSNP:rs782500780Ensembl.	1
Natural variantⁱVAR_007868	174	M → R in dRTA-D. 1 Publication	1
Natural variantⁱVAR_007869	275	T → P in dRTA-D. 2 Publications	1
Natural variantⁱVAR_007870	316	G → E in dRTA-D. 1 Publication	1
Natural variantⁱVAR_007871	346	P → R in dRTA-D. 3 PublicationsCorresponds to variant dbSNP:rs781838938EnsemblClinVar.	1
Natural variantⁱVAR_007872	364	G → S in dRTA-D. 1 Publication	1

Mutagenesis

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Mutagenesisⁱ	513	L → G: Loss of interactions with SLC9A3R1 and SCL4A7. 1 Publication		1

Keywords - Diseaseⁱ

Deafness, Disease mutation

Organism-specific databases

DisGeNET More...DisGeNETⁱ	525
MalaCards human disease database More...MalaCardsⁱ	ATP6V1B1
MIMⁱ	267300 phenotype
Open Targets More...OpenTargetsⁱ	ENSG00000116039
Orphanetⁱ	402041 Autosomal recessive distal renal tubular acidosis
PharmGKBⁱ	PA25154

Chemistry databases

ChEMBLⁱ	CHEMBL3217

ChEMBLⁱ

CHEMBL3217

Polymorphism and mutation databases

BioMutaⁱ	ATP6V1B1
DMDMⁱ	215274116

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000144624	1 – 513	V-type proton ATPase subunit B, kidney isoformAdd BLAST		513

Proteomic databases

EPDⁱ	P15313
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P15313
PaxDbⁱ	P15313
PeptideAtlas More...PeptideAtlasⁱ	P15313
PRIDEⁱ	P15313
ProteomicsDBⁱ	53129

PTM databases

iPTMnetⁱ	P15313
PhosphoSitePlusⁱ	P15313

Expressionⁱ

Tissue specificityⁱ

Gene expression databases

Bgeeⁱ	ENSG00000116039 Expressed in 102 organ(s), highest expression level in adult mammalian kidney
CleanExⁱ	HS_ATP6V1B1
ExpressionAtlasⁱ	P15313 baseline and differential
Genevisibleⁱ	P15313 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB009523 HPA031847

HPAⁱ

CAB009523
HPA031847

Interactionⁱ

Subunit structureⁱ

V-ATPase is a heteromultimeric enzyme composed of a peripheral catalytic V1 complex (main components: subunits A, B, C, D, E, and F) attached to an integral membrane V0 proton pore complex (main component: the proteolipid protein). Forms a complex with SLC9A3R1 and SCL4A7.

Protein-protein interaction databases

BioGridⁱ	107008, 96 interactors
IntActⁱ	P15313, 6 interactors
Molecular INTeraction database More...MINTⁱ	P15313
STRINGⁱ	9606.ENSP00000234396

Chemistry databases

BindingDBⁱ

P15313

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	P15313
SMRⁱ	P15313
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Motif

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Motifⁱ	510 – 513	PDZ-binding		4

Domainⁱ

The PDZ-binding motif mediates interactions with SLC9A3R1 and SCL4A7.1 Publication

Sequence similaritiesⁱ

Belongs to the ATPase alpha/beta chains family.Curated

Phylogenomic databases

eggNOGⁱ	KOG1351 Eukaryota COG1156 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00550000074724
HOGENOMⁱ	HOG000165320
HOVERGENⁱ	HBG002176
InParanoidⁱ	P15313
KEGG Orthology (KO) More...KOⁱ	K02147
OMAⁱ	MLIEHSE
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G04TR
PhylomeDBⁱ	P15313
TreeFamⁱ	TF300313

Family and domain databases

HAMAPⁱ	MF_00310 ATP_synth_B_arch, 1 hit
InterProⁱ	View protein in InterPro IPR020003 ATPase_a/bsu_AS IPR004100 ATPase_F1/V1/A1_a/bsu_N IPR000194 ATPase_F1/V1/A1_a/bsu_nucl-bd IPR005723 ATPase_V1-cplx_bsu IPR027417 P-loop_NTPase IPR022879 V-ATPase_su_B/beta
PANTHERⁱ	PTHR43389 PTHR43389, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00006 ATP-synt_ab, 1 hit PF02874 ATP-synt_ab_N, 1 hit
PIRSFⁱ	PIRSF039114 V-ATPsynth_beta/V-ATPase_B, 1 hit
SUPFAMⁱ	SSF52540 SSF52540, 1 hit
TIGRFAMsⁱ	TIGR01040 V-ATPase_V1_B, 1 hit
PROSITEⁱ	View protein in PROSITE PS00152 ATPASE_ALPHA_BETA, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 3 potential isoforms that are computationally mapped.Show all Align All

P15313-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MAMEIDSRPG GLPGSSCNLG AAREHMQAVT RNYITHPRVT YRTVCSVNGP 
        60         70         80         90        100
LVVLDRVKFA QYAEIVHFTL PDGTQRSGQV LEVAGTKAIV QVFEGTSGID 
       110        120        130        140        150
ARKTTCEFTG DILRTPVSED MLGRVFNGSG KPIDKGPVVM AEDFLDINGQ 
       160        170        180        190        200
PINPHSRIYP EEMIQTGISP IDVMNSIARG QKIPIFSAAG LPHNEIAAQI 
       210        220        230        240        250
CRQAGLVKKS KAVLDYHDDN FAIVFAAMGV NMETARFFKS DFEQNGTMGN 
       260        270        280        290        300
VCLFLNLAND PTIERIITPR LALTTAEFLA YQCEKHVLVI LTDMSSYAEA 
       310        320        330        340        350
LREVSAAREE VPGRRGFPGY MYTDLATIYE RAGRVEGRGG SITQIPILTM 
       360        370        380        390        400
PNDDITHPIP DLTGFITEGQ IYVDRQLHNR QIYPPINVLP SLSRLMKSAI 
       410        420        430        440        450
GEGMTRKDHG DVSNQLYACY AIGKDVQAMK AVVGEEALTS EDLLYLEFLQ 
       460        470        480        490        500
KFEKNFINQG PYENRSVFES LDLGWKLLRI FPKEMLKRIP QAVIDEFYSR 
       510 
EGALQDLAPD TAL

Length:513

Mass (Da):56,833

Last modified:November 25, 2008 - v3

Checksum:ⁱ5399E2849F3B99AA

Computationally mapped potential isoform sequencesⁱ

There are 3 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

C9JL73	C9JL73_HUMAN	V-type proton ATPase subunit B, kid... V-type proton ATPase subunit B, kidney isoform	ATP6V1B1	496	Annotation score:
C9JNS9	C9JNS9_HUMAN	V-type proton ATPase subunit B, kid... V-type proton ATPase subunit B, kidney isoform	ATP6V1B1	310	Annotation score:
C9JZ02	C9JZ02_HUMAN	V-type proton ATPase subunit B, kid... V-type proton ATPase subunit B, kidney isoform	ATP6V1B1	157	Annotation score:

Sequence cautionⁱ

The sequence AAA36498 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	467	V → M in AAA36498 (PubMed:2527371).Curated	1
Sequence conflictⁱ	474	G → S in AAA36498 (PubMed:2527371).Curated	1
Sequence conflictⁱ	503	A → R in AAA36498 (PubMed:2527371).Curated	1

Natural variant

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_021011	30	T → I2 PublicationsCorresponds to variant dbSNP:rs17720303EnsemblClinVar.	1
Natural variantⁱVAR_007866	81	L → P in dRTA-D. 3 PublicationsCorresponds to variant dbSNP:rs121964880EnsemblClinVar.	1
Natural variantⁱVAR_021012	123	G → V in dRTA-D. 1 Publication	1
Natural variantⁱVAR_007867	124	R → W in dRTA-D. 1 PublicationCorresponds to variant dbSNP:rs727505222EnsemblClinVar.	1
Natural variantⁱVAR_021013	157	R → C in dRTA-D. 1 PublicationCorresponds to variant dbSNP:rs782500780Ensembl.	1
Natural variantⁱVAR_021014	161	E → K1 PublicationCorresponds to variant dbSNP:rs114234874EnsemblClinVar.	1
Natural variantⁱVAR_007868	174	M → R in dRTA-D. 1 Publication	1
Natural variantⁱVAR_007869	275	T → P in dRTA-D. 2 Publications	1
Natural variantⁱVAR_007870	316	G → E in dRTA-D. 1 Publication	1
Natural variantⁱVAR_007871	346	P → R in dRTA-D. 3 PublicationsCorresponds to variant dbSNP:rs781838938EnsemblClinVar.	1
Natural variantⁱVAR_007872	364	G → S in dRTA-D. 1 Publication	1
Natural variantⁱVAR_021015	465	R → H2 PublicationsCorresponds to variant dbSNP:rs142905621EnsemblClinVar.	1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M25809 mRNA Translation: AAA36498.1 Different initiation. AK291121 mRNA Translation: BAF83810.1 AK313194 mRNA Translation: BAG36011.1 AK223151 mRNA Translation: BAD96871.1 CH471053 Genomic DNA Translation: EAW99790.1 BC063411 mRNA Translation: AAH63411.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS1912.1
PIRⁱ	A33281
NCBI Reference Sequences More...RefSeqⁱ	NP_001683.2, NM_001692.3
UniGeneⁱ	Hs.64173

Genome annotation databases

Ensemblⁱ	ENST00000234396; ENSP00000234396; ENSG00000116039
GeneIDⁱ	525
KEGGⁱ	hsa:525
UCSC genome browser More...UCSCⁱ	uc002shj.4 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P15313	cDNA FLJ57632, highly similar to Vacuolar ATP synthase subunit B, kidney isoform		HUMAN		488	UniRef100_P15313
H+-ATPase beta 1 subunit (Fragment)		HUMAN		426

Protein	Similar proteins		Species	Score	Length	Source
P15313	V-type proton ATPase subunit B, kidney isoform		BOVIN		513	UniRef90_P15313
cDNA FLJ57632, highly similar to Vacuolar ATP synthase subunit B, kidney isoform		HUMAN		488
ATPase H+-transporting V1 subunit B1		RAT		611
V-type proton ATPase subunit B, kidney isoform		NEOSC		513
Uncharacterized protein		RABIT		513
+116

Protein	Similar proteins		Species	Score	Length	Source
P15313	V-type proton ATPase subunit B, kidney isoform		BOVIN		513	UniRef50_P15313
V-type proton ATPase subunit B		HELVI		494
V-type proton ATPase subunit B		MANSE		494
cDNA FLJ57632, highly similar to Vacuolar ATP synthase subunit B, kidney isoform		HUMAN		488
ATPase H+-transporting V1 subunit B1		RAT		611
+309

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M25809 mRNA Translation: AAA36498.1 Different initiation. AK291121 mRNA Translation: BAF83810.1 AK313194 mRNA Translation: BAG36011.1 AK223151 mRNA Translation: BAD96871.1 CH471053 Genomic DNA Translation: EAW99790.1 BC063411 mRNA Translation: AAH63411.1
CCDSⁱ	CCDS1912.1
PIRⁱ	A33281
RefSeqⁱ	NP_001683.2, NM_001692.3
UniGeneⁱ	Hs.64173

3D structure databases

ProteinModelPortalⁱ	P15313
SMRⁱ	P15313
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	107008, 96 interactors
IntActⁱ	P15313, 6 interactors
MINTⁱ	P15313
STRINGⁱ	9606.ENSP00000234396

Chemistry databases

BindingDBⁱ	P15313
ChEMBLⁱ	CHEMBL3217

Protein family/group databases

TCDBⁱ	3.A.2.2.4 the h(+)- or na(+)-translocating f-type, v-type and a-type atpase (f-atpase) superfamily

TCDBⁱ

3.A.2.2.4 the h(+)- or na(+)-translocating f-type, v-type and a-type atpase (f-atpase) superfamily

PTM databases

iPTMnetⁱ	P15313
PhosphoSitePlusⁱ	P15313

Polymorphism and mutation databases

BioMutaⁱ	ATP6V1B1
DMDMⁱ	215274116

Proteomic databases

EPDⁱ	P15313
MaxQBⁱ	P15313
PaxDbⁱ	P15313
PeptideAtlasⁱ	P15313
PRIDEⁱ	P15313
ProteomicsDBⁱ	53129

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000234396; ENSP00000234396; ENSG00000116039
GeneIDⁱ	525
KEGGⁱ	hsa:525
UCSCⁱ	uc002shj.4 human

Organism-specific databases

CTDⁱ	525
DisGeNETⁱ	525
EuPathDBⁱ	HostDB:ENSG00000116039.11
GeneCardsⁱ	ATP6V1B1
HGNCⁱ	HGNC:853 ATP6V1B1
HPAⁱ	CAB009523 HPA031847
MalaCardsⁱ	ATP6V1B1
MIMⁱ	192132 gene 267300 phenotype
neXtProtⁱ	NX_P15313
OpenTargetsⁱ	ENSG00000116039
Orphanetⁱ	402041 Autosomal recessive distal renal tubular acidosis
PharmGKBⁱ	PA25154
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG1351 Eukaryota COG1156 LUCA
GeneTreeⁱ	ENSGT00550000074724
HOGENOMⁱ	HOG000165320
HOVERGENⁱ	HBG002176
InParanoidⁱ	P15313
KOⁱ	K02147
OMAⁱ	MLIEHSE
OrthoDBⁱ	EOG091G04TR
PhylomeDBⁱ	P15313
TreeFamⁱ	TF300313

Enzyme and pathway databases

BioCycⁱ	MetaCyc:HS03975-MONOMER
Reactomeⁱ	R-HSA-1222556 ROS, RNS production in phagocytes R-HSA-77387 Insulin receptor recycling R-HSA-917977 Transferrin endocytosis and recycling R-HSA-983712 Ion channel transport

Miscellaneous databases

GeneWikiⁱ	ATP6V1B1
GenomeRNAiⁱ	525
Protein Ontology More...PROⁱ	PR:P15313
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000116039 Expressed in 102 organ(s), highest expression level in adult mammalian kidney
CleanExⁱ	HS_ATP6V1B1
ExpressionAtlasⁱ	P15313 baseline and differential
Genevisibleⁱ	P15313 HS

Family and domain databases

HAMAPⁱ	MF_00310 ATP_synth_B_arch, 1 hit
InterProⁱ	View protein in InterPro IPR020003 ATPase_a/bsu_AS IPR004100 ATPase_F1/V1/A1_a/bsu_N IPR000194 ATPase_F1/V1/A1_a/bsu_nucl-bd IPR005723 ATPase_V1-cplx_bsu IPR027417 P-loop_NTPase IPR022879 V-ATPase_su_B/beta
PANTHERⁱ	PTHR43389 PTHR43389, 1 hit
Pfamⁱ	View protein in Pfam PF00006 ATP-synt_ab, 1 hit PF02874 ATP-synt_ab_N, 1 hit
PIRSFⁱ	PIRSF039114 V-ATPsynth_beta/V-ATPase_B, 1 hit
SUPFAMⁱ	SSF52540 SSF52540, 1 hit
TIGRFAMsⁱ	TIGR01040 V-ATPase_V1_B, 1 hit
PROSITEⁱ	View protein in PROSITE PS00152 ATPASE_ALPHA_BETA, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	VATB1_HUMAN
Accessionⁱ	P15313Primary (citable) accession number: P15313 Secondary accession number(s): Q53FY0, Q6P4H6
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	April 1, 1990
	Last sequence update:	November 25, 2008
	Last modified:	November 7, 2018
	This is version 198 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 2
Human chromosome 2: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P15313 (VATB1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

V-type proton ATPase subunit B, kidney isoform

ATP6V1B1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Protein family/group databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Cytosol

Extracellular region or secreted

Plasma Membrane

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Keywords - Diseasei

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Chemistry databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

Protein family/group databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

Keywords - Diseaseⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Sequence cautionⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ