UniProtKB - P15313 (VATB1_HUMAN)
(max 400 entries)x
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|P15313|VATB1_HUMAN V-type proton ATPase subunit B, kidney isoform OS=Homo sapiens OX=9606 GN=ATP6V1B1 PE=1 SV=3 MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFA QYAEIVHFTLPDGTQRSGQVLEVAGTKAIVQVFEGTSGIDARKTTCEFTGDILRTPVSED MLGRVFNGSGKPIDKGPVVMAEDFLDINGQPINPHSRIYPEEMIQTGISPIDVMNSIARG QKIPIFSAAGLPHNEIAAQICRQAGLVKKSKAVLDYHDDNFAIVFAAMGVNMETARFFKS DFEQNGTMGNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEA LREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRGGSITQIPILTMPNDDITHPIP DLTGFITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYACY AIGKDVQAMKAVVGEEALTSEDLLYLEFLQKFEKNFINQGPYENRSVFESLDLGWKLLRI FPKEMLKRIPQAVIDEFYSREGALQDLAPDTAL
- Align
Protein
V-type proton ATPase subunit B, kidney isoform
Gene
ATP6V1B1
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
Non-catalytic subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- ATP binding Source: InterPro
- hydrolase activity Source: UniProtKB-KW
- protein-containing complex binding Source: Ensembl
- proton transmembrane transporter activity Source: UniProtKB <p>Inferred from Sequence or Structural Similarity <br />Used for any analysis based on sequence alignment, structure comparison, or evaluation of sequence features such as composition.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#iss">GO evidence code guide</a></p> Inferred from sequence or structural similarityi
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- ATP hydrolysis coupled proton transport Source: InterPro
- ATP metabolic process Source: InterPro
- calcium ion homeostasis Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- excretion Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- inner ear morphogenesis Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- insulin receptor signaling pathway Source: Reactome
- ion transmembrane transport Source: Reactome
- ossification Source: HGNC <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- pH reduction Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- proton transmembrane transport Source: HGNC <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- regulation of macroautophagy Source: ParkinsonsUK-UCL <p>Non-traceable Author Statement</p> <p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p> Non-traceable author statementi
- regulation of pH Source: HGNC <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- sensory perception of sound Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- transferrin transport Source: Reactome
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Molecular function | Hydrolase |
| Biological process | Hydrogen ion transport, Ion transport, Transport |
Enzyme and pathway databases
BioCyc Collection of Pathway/Genome Databases More...BioCyci | MetaCyc:HS03975-MONOMER |
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-HSA-1222556 ROS, RNS production in phagocytes R-HSA-77387 Insulin receptor recycling R-HSA-917977 Transferrin endocytosis and recycling R-HSA-983712 Ion channel transport |
Protein family/group databases
Transport Classification Database More...TCDBi | 3.A.2.2.4 the h(+)- or na(+)-translocating f-type, v-type and a-type atpase (f-atpase) superfamily |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: V-type proton ATPase subunit B, kidney isoformShort name: V-ATPase subunit B 1 Alternative name(s): Endomembrane proton pump 58 kDa subunit Vacuolar proton pump subunit B 1 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:ATP6V1B1 Synonyms:ATP6B1, VATB, VPP3 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Homo sapiens (Human) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9606 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000116039.11 |
Human Gene Nomenclature Database More...HGNCi | HGNC:853 ATP6V1B1 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 192132 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_P15313 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Other locations
Note: Endomembrane.
Cytosol
- cytosol Source: Reactome
Extracellular region or secreted
- extracellular exosome Source: UniProtKBInferred from high throughput direct assayi
Plasma Membrane
- apical plasma membrane Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- basolateral plasma membrane Source: UniProtKB <p>Inferred from Sequence or Structural Similarity <br />Used for any analysis based on sequence alignment, structure comparison, or evaluation of sequence features such as composition.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#iss">GO evidence code guide</a></p> Inferred from sequence or structural similarityi
- lateral plasma membrane Source: UniProtKB <p>Inferred from Sequence or Structural Similarity <br />Used for any analysis based on sequence alignment, structure comparison, or evaluation of sequence features such as composition.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#iss">GO evidence code guide</a></p> Inferred from sequence or structural similarityi
Other locations
- cytoplasm Source: UniProtKB <p>Inferred from Sequence or Structural Similarity <br />Used for any analysis based on sequence alignment, structure comparison, or evaluation of sequence features such as composition.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#iss">GO evidence code guide</a></p> Inferred from sequence or structural similarityi
- extrinsic component of synaptic vesicle membrane Source: Ensembl
- microvillus Source: UniProtKB <p>Inferred from Sequence or Structural Similarity <br />Used for any analysis based on sequence alignment, structure comparison, or evaluation of sequence features such as composition.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#iss">GO evidence code guide</a></p> Inferred from sequence or structural similarityi
- proton-transporting V-type ATPase, V1 domain Source: InterPro
- vacuolar proton-transporting V-type ATPase complex Source: HGNC <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti
Membrane<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei
Renal tubular acidosis, distal, with progressive nerve deafness (dRTA-D)3 Publications
<p>Manually curated information for which there is published experimental evidence.</p>
<p><a href="/manual/evidences#ECO:0000269">More...</a></p>
Manual assertion based on experiment ini
- Ref.7"Mutations in the gene encoding B1 subunit of H+-ATPase cause renal tubular acidosis with sensorineural deafness."
Karet F.E., Finberg K.E., Nelson R.D., Nayir A., Mocan H., Sanjad S.A., Rodriguez-Soriano J., Santos F., Cremers C.W.R.J., Di Pietro A., Hoffbrand B.I., Winiarski J., Bakkaloglu A., Ozen S., Dusunsel R., Goodyer P., Hulton S.A., Wu D.K. , Skvorak A.B., Morton C.C., Cunningham M.J., Jha V., Lifton R.P.
Nat. Genet. 21:84-90(1999) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANTS DRTA-D PRO-81; TRP-124; ARG-174; PRO-275; GLU-316; ARG-346 AND SER-364, TISSUE SPECIFICITY. - Ref.8"Novel ATP6V1B1 and ATP6V0A4 mutations in autosomal recessive distal renal tubular acidosis with new evidence for hearing loss."
Stover E.H., Borthwick K.J., Bavalia C., Eady N., Fritz D.M., Rungroj N., Giersch A.B.S., Morton C.C., Axon P.R., Akil I., Al-Sabban E.A., Baguley D.M., Bianca S., Bakkaloglu A., Bircan Z., Chauveau D., Clermont M.-J., Guala A. , Hulton S.A., Kroes H., Li Volti G., Mir S., Mocan H., Nayir A., Ozen S., Rodriguez Soriano J., Sanjad S.A., Tasic V., Taylor C.M., Topaloglu R., Smith A.N., Karet F.E.
J. Med. Genet. 39:796-803(2002) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANTS DRTA-D PRO-81; VAL-123; CYS-157; PRO-275 AND ARG-346, VARIANTS ILE-30 AND LYS-161. - Ref.9"Confirmation of the ATP6B1 gene as responsible for distal renal tubular acidosis."
Ruf R., Rensing C., Topaloglu R., Guay-Woodford L., Klein C., Vollmer M., Otto E., Beekmann F., Haller M., Wiedensohler A., Leumann E., Antignac C., Rizzoni G., Filler G., Brandis M., Weber J.L., Hildebrandt F.
Pediatr. Nephrol. 18:105-109(2003) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANT HIS-465, VARIANTS DRTA-D PRO-81 AND ARG-346.
Ref.7
"Mutations in the gene encoding B1 subunit of H+-ATPase cause renal tubular acidosis with sensorineural deafness."
Karet F.E., Finberg K.E., Nelson R.D., Nayir A., Mocan H., Sanjad S.A., Rodriguez-Soriano J., Santos F., Cremers C.W.R.J., Di Pietro A., Hoffbrand B.I., Winiarski J., Bakkaloglu A., Ozen S., Dusunsel R., Goodyer P., Hulton S.A., Wu D.K. , Skvorak A.B., Morton C.C., Cunningham M.J., Jha V., Lifton R.P.
Nat. Genet. 21:84-90(1999) [PubMed] [Europe PMC] [Abstract]
Karet F.E., Finberg K.E., Nelson R.D., Nayir A., Mocan H., Sanjad S.A., Rodriguez-Soriano J., Santos F., Cremers C.W.R.J., Di Pietro A., Hoffbrand B.I., Winiarski J., Bakkaloglu A., Ozen S., Dusunsel R., Goodyer P., Hulton S.A., Wu D.K. , Skvorak A.B., Morton C.C., Cunningham M.J., Jha V., Lifton R.P.
Nat. Genet. 21:84-90(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS DRTA-D PRO-81; TRP-124; ARG-174; PRO-275; GLU-316; ARG-346 AND SER-364, TISSUE SPECIFICITY.
Ref.8
"Novel ATP6V1B1 and ATP6V0A4 mutations in autosomal recessive distal renal tubular acidosis with new evidence for hearing loss."
Stover E.H., Borthwick K.J., Bavalia C., Eady N., Fritz D.M., Rungroj N., Giersch A.B.S., Morton C.C., Axon P.R., Akil I., Al-Sabban E.A., Baguley D.M., Bianca S., Bakkaloglu A., Bircan Z., Chauveau D., Clermont M.-J., Guala A. , Hulton S.A., Kroes H., Li Volti G., Mir S., Mocan H., Nayir A., Ozen S., Rodriguez Soriano J., Sanjad S.A., Tasic V., Taylor C.M., Topaloglu R., Smith A.N., Karet F.E.
J. Med. Genet. 39:796-803(2002) [PubMed] [Europe PMC] [Abstract]
Stover E.H., Borthwick K.J., Bavalia C., Eady N., Fritz D.M., Rungroj N., Giersch A.B.S., Morton C.C., Axon P.R., Akil I., Al-Sabban E.A., Baguley D.M., Bianca S., Bakkaloglu A., Bircan Z., Chauveau D., Clermont M.-J., Guala A. , Hulton S.A., Kroes H., Li Volti G., Mir S., Mocan H., Nayir A., Ozen S., Rodriguez Soriano J., Sanjad S.A., Tasic V., Taylor C.M., Topaloglu R., Smith A.N., Karet F.E.
J. Med. Genet. 39:796-803(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS DRTA-D PRO-81; VAL-123; CYS-157; PRO-275 AND ARG-346, VARIANTS ILE-30 AND LYS-161.
Ref.9
"Confirmation of the ATP6B1 gene as responsible for distal renal tubular acidosis."
Ruf R., Rensing C., Topaloglu R., Guay-Woodford L., Klein C., Vollmer M., Otto E., Beekmann F., Haller M., Wiedensohler A., Leumann E., Antignac C., Rizzoni G., Filler G., Brandis M., Weber J.L., Hildebrandt F.
Pediatr. Nephrol. 18:105-109(2003) [PubMed] [Europe PMC] [Abstract]
Ruf R., Rensing C., Topaloglu R., Guay-Woodford L., Klein C., Vollmer M., Otto E., Beekmann F., Haller M., Wiedensohler A., Leumann E., Antignac C., Rizzoni G., Filler G., Brandis M., Weber J.L., Hildebrandt F.
Pediatr. Nephrol. 18:105-109(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT HIS-465, VARIANTS DRTA-D PRO-81 AND ARG-346.
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disease characterized by the association of renal distal tubular acidosis with sensorineural hearing loss. Distal renal tubular acidosis is characterized by reduced ability to acidify urine, variable hyperchloremic hypokalemic metabolic acidosis, nephrocalcinosis, and nephrolithiasis. It is due to functional failure of alpha-intercalated cells of the cortical collecting duct of the distal nephron, where vectorial proton transport is required for urinary acidification.
See also OMIM:267300| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_007866 | 81 | L → P in dRTA-D. 3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_021012 | 123 | G → V in dRTA-D. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_007867 | 124 | R → W in dRTA-D. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_021013 | 157 | R → C in dRTA-D. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_007868 | 174 | M → R in dRTA-D. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_007869 | 275 | T → P in dRTA-D. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_007870 | 316 | G → E in dRTA-D. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_007871 | 346 | P → R in dRTA-D. 3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_007872 | 364 | G → S in dRTA-D. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
Mutagenesis
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 513 | L → G: Loss of interactions with SLC9A3R1 and SCL4A7. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Diseasei
Deafness, Disease mutationOrganism-specific databases
DisGeNET More...DisGeNETi | 525 |
MalaCards human disease database More...MalaCardsi | ATP6V1B1 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 267300 phenotype |
Open Targets More...OpenTargetsi | ENSG00000116039 |
Orphanet; a database dedicated to information on rare diseases and orphan drugs More...Orphaneti | 402041 Autosomal recessive distal renal tubular acidosis |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA25154 |
Chemistry databases
ChEMBL database of bioactive drug-like small molecules More...ChEMBLi | CHEMBL3217 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | ATP6V1B1 |
Domain mapping of disease mutations (DMDM) More...DMDMi | 215274116 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000144624 | 1 – 513 | V-type proton ATPase subunit B, kidney isoformAdd BLAST | 513 |
Proteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | P15313 |
MaxQB - The MaxQuant DataBase More...MaxQBi | P15313 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P15313 |
PeptideAtlas More...PeptideAtlasi | P15313 |
PRoteomics IDEntifications database More...PRIDEi | P15313 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 53129 |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | P15313 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | P15313 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
Expressed in the cochlea and endolymphatic sac.1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.7"Mutations in the gene encoding B1 subunit of H+-ATPase cause renal tubular acidosis with sensorineural deafness."
Karet F.E., Finberg K.E., Nelson R.D., Nayir A., Mocan H., Sanjad S.A., Rodriguez-Soriano J., Santos F., Cremers C.W.R.J., Di Pietro A., Hoffbrand B.I., Winiarski J., Bakkaloglu A., Ozen S., Dusunsel R., Goodyer P., Hulton S.A., Wu D.K. , Skvorak A.B., Morton C.C., Cunningham M.J., Jha V., Lifton R.P.
Nat. Genet. 21:84-90(1999) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANTS DRTA-D PRO-81; TRP-124; ARG-174; PRO-275; GLU-316; ARG-346 AND SER-364, TISSUE SPECIFICITY.
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000116039 |
CleanEx database of gene expression profiles More...CleanExi | HS_ATP6V1B1 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | P15313 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | P15313 HS |
Organism-specific databases
Human Protein Atlas More...HPAi | CAB009523 HPA031847 |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
V-ATPase is a heteromultimeric enzyme composed of a peripheral catalytic V1 complex (main components: subunits A, B, C, D, E, and F) attached to an integral membrane V0 proton pore complex (main component: the proteolipid protein). Forms a complex with SLC9A3R1 and SCL4A7.
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 107008, 96 interactors |
Protein interaction database and analysis system More...IntActi | P15313, 5 interactors |
Molecular INTeraction database More...MINTi | P15313 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000234396 |
Chemistry databases
BindingDB database of measured binding affinities More...BindingDBi | P15313 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P15313 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P15313 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Motif
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi | 510 – 513 | PDZ-binding | 4 |
<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini
The PDZ-binding motif mediates interactions with SLC9A3R1 and SCL4A7.1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.6"The COOH termini of NBC3 and the 56-kDa H+-ATPase subunit are PDZ motifs involved in their interaction."
Pushkin A., Abuladze N., Newman D., Muronets V., Sassani P., Tatishchev S., Kurtz I.
Am. J. Physiol. 284:C667-C673(2003) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH SLC9A3R1 AND SLC4A7, DOMAIN, MUTAGENESIS OF LEU-513.
<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
Belongs to the ATPase alpha/beta chains family.Curated
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG1351 Eukaryota COG1156 LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00550000074724 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000165320 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG002176 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P15313 |
KEGG Orthology (KO) More...KOi | K02147 |
Identification of Orthologs from Complete Genome Data More...OMAi | QVKFAQY |
Database of Orthologous Groups More...OrthoDBi | EOG091G04TR |
Database for complete collections of gene phylogenies More...PhylomeDBi | P15313 |
TreeFam database of animal gene trees More...TreeFami | TF300313 |
Family and domain databases
HAMAP database of protein families More...HAMAPi | MF_00310 ATP_synth_B_arch, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR020003 ATPase_a/bsu_AS IPR004100 ATPase_F1/V1/A1_a/bsu_N IPR000194 ATPase_F1/V1/A1_a/bsu_nucl-bd IPR005723 ATPase_V1-cplx_bsu IPR027417 P-loop_NTPase IPR022879 V-ATPase_su_B/beta |
The PANTHER Classification System More...PANTHERi | PTHR43389 PTHR43389, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF00006 ATP-synt_ab, 1 hit PF02874 ATP-synt_ab_N, 1 hit |
PIRSF; a whole-protein classification database More...PIRSFi | PIRSF039114 V-ATPsynth_beta/V-ATPase_B, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF52540 SSF52540, 1 hit |
TIGRFAMs; a protein family database More...TIGRFAMsi | TIGR01040 V-ATPase_V1_B, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS00152 ATPASE_ALPHA_BETA, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequencei
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
P15313-1 [UniParc]FASTAAdd to basketAdded to basketShow »
10 20 30 40 50
MAMEIDSRPG GLPGSSCNLG AAREHMQAVT RNYITHPRVT YRTVCSVNGP
60 70 80 90 100
LVVLDRVKFA QYAEIVHFTL PDGTQRSGQV LEVAGTKAIV QVFEGTSGID
110 120 130 140 150
ARKTTCEFTG DILRTPVSED MLGRVFNGSG KPIDKGPVVM AEDFLDINGQ
160 170 180 190 200
PINPHSRIYP EEMIQTGISP IDVMNSIARG QKIPIFSAAG LPHNEIAAQI
210 220 230 240 250
CRQAGLVKKS KAVLDYHDDN FAIVFAAMGV NMETARFFKS DFEQNGTMGN
260 270 280 290 300
VCLFLNLAND PTIERIITPR LALTTAEFLA YQCEKHVLVI LTDMSSYAEA
310 320 330 340 350
LREVSAAREE VPGRRGFPGY MYTDLATIYE RAGRVEGRGG SITQIPILTM
360 370 380 390 400
PNDDITHPIP DLTGFITEGQ IYVDRQLHNR QIYPPINVLP SLSRLMKSAI
410 420 430 440 450
GEGMTRKDHG DVSNQLYACY AIGKDVQAMK AVVGEEALTS EDLLYLEFLQ
460 470 480 490 500
KFEKNFINQG PYENRSVFES LDLGWKLLRI FPKEMLKRIP QAVIDEFYSR
510
EGALQDLAPD TAL
Length:513
Mass (Da):56,833
Last modified:November 25, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i5399E2849F3B99AA
<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni
The sequence AAA36498 differs from that shown. Reason: Erroneous initiation.Curated
Experimental Info
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti | 467 | V → M in AAA36498 (PubMed:2527371).Curated | 1 | |
| <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti | 474 | G → S in AAA36498 (PubMed:2527371).Curated | 1 | |
| <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti | 503 | A → R in AAA36498 (PubMed:2527371).Curated | 1 |
Natural variant
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_021011 | 30 | T → I2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_007866 | 81 | L → P in dRTA-D. 3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_021012 | 123 | G → V in dRTA-D. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_007867 | 124 | R → W in dRTA-D. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_021013 | 157 | R → C in dRTA-D. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_021014 | 161 | E → K1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_007868 | 174 | M → R in dRTA-D. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_007869 | 275 | T → P in dRTA-D. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_007870 | 316 | G → E in dRTA-D. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_007871 | 346 | P → R in dRTA-D. 3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_007872 | 364 | G → S in dRTA-D. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_021015 | 465 | R → H2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | M25809 mRNA Translation: AAA36498.1 Different initiation. AK291121 mRNA Translation: BAF83810.1 AK313194 mRNA Translation: BAG36011.1 AK223151 mRNA Translation: BAD96871.1 CH471053 Genomic DNA Translation: EAW99790.1 BC063411 mRNA Translation: AAH63411.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS1912.1 |
Protein sequence database of the Protein Information Resource More...PIRi | A33281 |
NCBI Reference Sequences More...RefSeqi | NP_001683.2, NM_001692.3 |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.64173 |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000234396; ENSP00000234396; ENSG00000116039 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 525 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:525 |
UCSC genome browser More...UCSCi | uc002shj.4 human |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi
Polymorphism<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P15313 | cDNA FLJ57632, highly similar to Vacuolar ATP synthase subunit B, kidney isoform (EC 3.6.3.14) | 488 | |||
| H+-ATPase beta 1 subunit (Fragment) | 426 |
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P15313 | cDNA FLJ57632, highly similar to Vacuolar ATP synthase subunit B, kidney isoform (EC 3.6.3.14) | 488 | |||
| ATPase H+-transporting V1 subunit B1 | 611 | ||||
| UPI000A280D2E | 522 | ||||
| UPI0003339982 | 514 | ||||
| UPI00032AEFD0 | 514 | ||||
| +109 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P15313 | cDNA FLJ57632, highly similar to Vacuolar ATP synthase subunit B, kidney isoform (EC 3.6.3.14) | 488 | |||
| ATPase H+-transporting V1 subunit B1 | 611 | ||||
| UPI000A280D2E | 522 | ||||
| UPI0003339982 | 514 | ||||
| UPI00032AEFD0 | 514 | ||||
| +457 | |||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | M25809 mRNA Translation: AAA36498.1 Different initiation. AK291121 mRNA Translation: BAF83810.1 AK313194 mRNA Translation: BAG36011.1 AK223151 mRNA Translation: BAD96871.1 CH471053 Genomic DNA Translation: EAW99790.1 BC063411 mRNA Translation: AAH63411.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS1912.1 |
Protein sequence database of the Protein Information Resource More...PIRi | A33281 |
NCBI Reference Sequences More...RefSeqi | NP_001683.2, NM_001692.3 |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.64173 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P15313 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P15313 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 107008, 96 interactors |
Protein interaction database and analysis system More...IntActi | P15313, 5 interactors |
Molecular INTeraction database More...MINTi | P15313 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000234396 |
Chemistry databases
BindingDB database of measured binding affinities More...BindingDBi | P15313 |
ChEMBL database of bioactive drug-like small molecules More...ChEMBLi | CHEMBL3217 |
Protein family/group databases
Transport Classification Database More...TCDBi | 3.A.2.2.4 the h(+)- or na(+)-translocating f-type, v-type and a-type atpase (f-atpase) superfamily |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | P15313 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | P15313 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | ATP6V1B1 |
Domain mapping of disease mutations (DMDM) More...DMDMi | 215274116 |
Proteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | P15313 |
MaxQB - The MaxQuant DataBase More...MaxQBi | P15313 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P15313 |
PeptideAtlas More...PeptideAtlasi | P15313 |
PRoteomics IDEntifications database More...PRIDEi | P15313 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 53129 |
Protocols and materials databases
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000234396; ENSP00000234396; ENSG00000116039 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 525 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:525 |
UCSC genome browser More...UCSCi | uc002shj.4 human |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 525 |
DisGeNET More...DisGeNETi | 525 |
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000116039.11 |
GeneCards: human genes, protein and diseases More...GeneCardsi | ATP6V1B1 |
Human Gene Nomenclature Database More...HGNCi | HGNC:853 ATP6V1B1 |
Human Protein Atlas More...HPAi | CAB009523 HPA031847 |
MalaCards human disease database More...MalaCardsi | ATP6V1B1 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 192132 gene 267300 phenotype |
neXtProt; the human protein knowledge platform More...neXtProti | NX_P15313 |
Open Targets More...OpenTargetsi | ENSG00000116039 |
Orphanet; a database dedicated to information on rare diseases and orphan drugs More...Orphaneti | 402041 Autosomal recessive distal renal tubular acidosis |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA25154 |
GenAtlas: human gene database More...GenAtlasi | Search... |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG1351 Eukaryota COG1156 LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00550000074724 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000165320 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG002176 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P15313 |
KEGG Orthology (KO) More...KOi | K02147 |
Identification of Orthologs from Complete Genome Data More...OMAi | QVKFAQY |
Database of Orthologous Groups More...OrthoDBi | EOG091G04TR |
Database for complete collections of gene phylogenies More...PhylomeDBi | P15313 |
TreeFam database of animal gene trees More...TreeFami | TF300313 |
Enzyme and pathway databases
BioCyc Collection of Pathway/Genome Databases More...BioCyci | MetaCyc:HS03975-MONOMER |
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-HSA-1222556 ROS, RNS production in phagocytes R-HSA-77387 Insulin receptor recycling R-HSA-917977 Transferrin endocytosis and recycling R-HSA-983712 Ion channel transport |
Miscellaneous databases
The Gene Wiki collection of pages on human genes and proteins More...GeneWikii | ATP6V1B1 |
Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens More...GenomeRNAii | 525 |
Protein Ontology More...PROi | PR:P15313 |
The Stanford Online Universal Resource for Clones and ESTs More...SOURCEi | Search... |
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000116039 |
CleanEx database of gene expression profiles More...CleanExi | HS_ATP6V1B1 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | P15313 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | P15313 HS |
Family and domain databases
HAMAP database of protein families More...HAMAPi | MF_00310 ATP_synth_B_arch, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR020003 ATPase_a/bsu_AS IPR004100 ATPase_F1/V1/A1_a/bsu_N IPR000194 ATPase_F1/V1/A1_a/bsu_nucl-bd IPR005723 ATPase_V1-cplx_bsu IPR027417 P-loop_NTPase IPR022879 V-ATPase_su_B/beta |
The PANTHER Classification System More...PANTHERi | PTHR43389 PTHR43389, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF00006 ATP-synt_ab, 1 hit PF02874 ATP-synt_ab_N, 1 hit |
PIRSF; a whole-protein classification database More...PIRSFi | PIRSF039114 V-ATPsynth_beta/V-ATPase_B, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF52540 SSF52540, 1 hit |
TIGRFAMs; a protein family database More...TIGRFAMsi | TIGR01040 V-ATPase_V1_B, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS00152 ATPASE_ALPHA_BETA, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | VATB1_HUMAN | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | P15313Primary (citable) accession number: P15313 Secondary accession number(s): Q53FY0, Q6P4H6 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | April 1, 1990 |
| Last sequence update: | November 25, 2008 | |
| Last modified: | July 18, 2018 | |
| This is version 196 of the entry and version 3 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Chordata Protein Annotation Program | |
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
Complete proteome, Reference proteomeDocuments
- Human chromosome 2
Human chromosome 2: entries, gene names and cross-references to MIM - Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations - Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - SIMILARITY comments
Index of protein domains and families
