Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P15309 (PPAP_HUMAN)

Entry version 194 (10 Feb 2021)
Sequence version 3 (01 Mar 1992)
Previous versions | rss
Add a publicationFeedback
Protein

Prostatic acid phosphatase

Gene

ACP3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

A non-specific tyrosine phosphatase that dephosphorylates a diverse number of substrates under acidic conditions (pH 4-6) including alkyl, aryl, and acyl orthophosphate monoesters and phosphorylated proteins (PubMed:10506173, PubMed:15280042, PubMed:20498373, PubMed:9584846). Has lipid phosphatase activity and inactivates lysophosphatidic acid in seminal plasma (PubMed:10506173, PubMed:15280042).4 Publications
Tyrosine phosphatase that acts as a tumor suppressor of prostate cancer through dephosphorylation of ERBB2 and deactivation of MAPK-mediated signaling (PubMed:20498373). In addition to its tyrosine phosphatase activity has ecto-5'-nucleotidase activity in dorsal root ganglion (DRG) neurons. Generates adenosine from AMP which acts as a pain suppressor (By similarity).By similarity1 Publication
(Microbial infection) Forms amyloid beta-sheet fibrils in semen. These fibrils, termed SEVI (semen-derived enhancer of viral infection) capture HIV virions, attach them to target cells and enhance infection (PubMed:18083097, PubMed:19451623, PubMed:19897482). SEVI amyloid fibrils are degraded by polyphenol epigallocatechin-3-gallate (EGCG), a constituent of green tea (PubMed:19451623). Target cell attachment and enhancement of HIV infection is inhibited by surfen (PubMed:19897482). Also similarly boosts XMRV (xenotropic murine leukemia virus-related virus) infection (PubMed:19403677).4 Publications

Miscellaneous

Has been used as a diagnostic tool for staging metastatic prostatic cancer.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Phosphatase activity inhibited by L+-tartrate, and by its derivative, alpha-benzylaminobenzylphosphonic acid.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei43Substrate1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei44Nucleophile1 Publication1
Binding sitei47Substrate1 Publication1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei49Important for substrate specificity1
Binding sitei111Substrate1 Publication1
Sitei138Required for homodimerizationBy similarity1
Sitei144Required for homodimerizationBy similarity1
Sitei206Required for structural stability1 Publication1
Binding sitei289Substrate1 Publication1
Active sitei290Proton donor1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.1.3.2, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P15309

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6798695, Neutrophil degranulation

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		P15309

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001295 [P15309-1]

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Prostatic acid phosphataseCurated (EC:3.1.3.23 Publications)
Short name:
PAP
Alternative name(s):
5'-nucleotidase (EC:3.1.3.5By similarity)
Short name:
5'-NT
Acid phosphatase 3Imported
Ecto-5'-nucleotidase
Protein tyrosine phosphatase ACP31 Publication (EC:3.1.3.481 Publication)
Thiamine monophosphatase
Short name:
TMPase
Cleaved into the following chain:
PAPf39
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ACP3Imported
Synonyms:ACPP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:125, ACP3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		171790, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P15309

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000014257.15

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Amyloid, Cell membrane, Cytoplasm, Lysosome, Membrane, Nucleus, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi206W → F: Greatly reduced enzyme activity, marked decrease in structural stability, and increased binding of the inhibitor, L(+)-tartrate. 1 Publication1
Mutagenesisi206W → L: Reduced enzyme activity, marked decrease in structural stability, and increased binding of the inhibitor, L(+)-tartrate. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		55

Open Targets

More...OpenTargetsi		ENSG00000014257

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA24449

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P15309, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL2633

Drug and drug target database

More...DrugBanki		DB03390, (2R,3R)-2,3-Dihydroxy-4-oxo-4-(propylamino)butanoic acid
DB03577, Alpha-Benzyl-Aminobenzyl-Phosphonic Acid
DB06688, Sipuleucel-T

DrugCentral

More...DrugCentrali		P15309

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ACPP

Domain mapping of disease mutations (DMDM)

More...DMDMi		130730

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 321 PublicationAdd BLAST32
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002396333 – 386Prostatic acid phosphataseAdd BLAST354
<p>This subsection of the 'PTM / Processing' section describes the position and length of an active peptide in the mature protein.<p><a href='/help/peptide' target='_top'>More...</a></p>PeptideiPRO_0000411250248 – 286PAPf391 PublicationAdd BLAST39

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi94N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi161 ↔ 3722 Publications
Disulfide bondi215 ↔ 3131 Publication
Glycosylationi220N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi333N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi347 ↔ 3512 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated. High mannose content, partially sialylated and fucosylated biantennary complex. Also fucosylated with partially sialylated triantennary complex oligosaccharides.2 Publications
Proteolytically cleaved in seminal fluid to produce several peptides. Peptide PAPf39, the most prominent, forms amyloid beta-sheet fibrils, SEVI (semen-derived enhancer of viral infection).1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P15309

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P15309

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P15309

MaxQB - The MaxQuant DataBase

More...MaxQBi		P15309

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P15309

PeptideAtlas

More...PeptideAtlasi		P15309

PRoteomics IDEntifications database

More...PRIDEi		P15309

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		53126 [P15309-1]
53127 [P15309-2]
62789

PTM databases

DEPOD human dephosphorylation database

More...DEPODi		ACPP

GlyConnect protein glycosylation platform

More...GlyConnecti		2001, 6 N-Linked glycans (2 sites)

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P15309, 3 sites, 14 N-linked glycans (2 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P15309

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P15309

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in the prostate, restricted to glandular and ductal epithelial cells. Also expressed in bladder, kidney, pancreas, lung, cervix, testis and ovary. Weak expression in a subset of pancreatic islet cells, squamous epithelia, the pilosebaceous unit, colonic neuroendocrine cells and skin adnexal structures. Low expression in prostate carcinoma cells and tissues.2 Publications
Widely expressed. Expressed in the sarcolemma of skeletal muscle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000014257, Expressed in prostate gland and 163 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P15309, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P15309, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000014257, Tissue enriched (prostate)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; dimer formation is required for phosphatase activity.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		106571, 80 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-120, Prostatic acid phosphatase complex

Protein interaction database and analysis system

More...IntActi		P15309, 22 interactors

Molecular INTeraction database

More...MINTi		P15309

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000323036

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P15309

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P15309, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1386
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		P15309

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P15309

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P15309

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the histidine acid phosphatase family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3720, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160450

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_030431_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P15309

Identification of Orthologs from Complete Genome Data

More...OMAi		CEGVHNF

Database of Orthologous Groups

More...OrthoDBi		1221585at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P15309

TreeFam database of animal gene trees

More...TreeFami		TF312893

Family and domain databases

Conserved Domains Database

More...CDDi		cd07061, HP_HAP_like, 1 hit

Database of protein disorder

More...DisProti		DP00628

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.50.1240, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR033379, Acid_Pase_AS
IPR000560, His_Pase_clade-2
IPR029033, His_PPase_superfam

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00328, His_Phos_2, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF53254, SSF53254, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00616, HIS_ACID_PHOSPHAT_1, 1 hit
PS00778, HIS_ACID_PHOSPHAT_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P15309-1) [UniParc]FASTAAdd to basket
Also known as: Secreted PAP, sPAP

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRAAPLLLAR AASLSLGFLF LLFFWLDRSV LAKELKFVTL VFRHGDRSPI 
        60         70         80         90        100
DTFPTDPIKE SSWPQGFGQL TQLGMEQHYE LGEYIRKRYR KFLNESYKHE 
       110        120        130        140        150
QVYIRSTDVD RTLMSAMTNL AALFPPEGVS IWNPILLWQP IPVHTVPLSE 
       160        170        180        190        200
DQLLYLPFRN CPRFQELESE TLKSEEFQKR LHPYKDFIAT LGKLSGLHGQ 
       210        220        230        240        250
DLFGIWSKVY DPLYCESVHN FTLPSWATED TMTKLRELSE LSLLSLYGIH 
       260        270        280        290        300
KQKEKSRLQG GVLVNEILNH MKRATQIPSY KKLIMYSAHD TTVSGLQMAL 
       310        320        330        340        350
DVYNGLLPPY ASCHLTELYF EKGEYFVEMY YRNETQHEPY PLMLPGCSPS 
       360        370        380 
CPLERFAELV GPVIPQDWST ECMTTNSHQG TEDSTD
Length:386
Mass (Da):44,566
Last modified:March 1, 1992 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEF81E11DFAECADEA
GO
Isoform 2 (identifier: P15309-2) [UniParc]FASTAAdd to basket
Also known as: TMPase, TM-PAP1 Publication, cellular PAP, cPAP, cPAcP1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     380-386: GTEDSTD → VLKVIFAVAFCLISAVLMVLLFIHIRRGLCWQRESYGNI

Show »
Length:418
Mass (Da):48,336
Checksum:i68E1131197595362
GO
Isoform 3 (identifier: P15309-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     153-185: Missing.

Show »
Length:353
Mass (Da):40,443
Checksum:iC3E376122B63DA82
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PFE6E9PFE6_HUMAN
Prostatic acid phosphatase
ACP3
165Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y8T3H0Y8T3_HUMAN
Prostatic acid phosphatase
ACP3
99Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti15 – 24SLGFLFLLFF → AFASCFCFFC in CAA37673 (PubMed:2395659).Curated10
Sequence conflicti15 – 24SLGFLFLLFF → ALASCFCFFC in AAA60022 (PubMed:2712834).Curated10
Sequence conflicti15 – 24SLGFLFLLFF → ALASCFCFFC in CAA36422 (PubMed:2842184).Curated10
Sequence conflicti46D → H in CAA37673 (PubMed:2395659).Curated1
Sequence conflicti66 – 73GFGQLTQL → RIWPTHPA in CAA37673 (PubMed:2395659).Curated8
Sequence conflicti66 – 73GFGQLTQL → WIWPTHPA in CAA36422 (PubMed:2842184).Curated8
Sequence conflicti95E → D in AAA60022 (PubMed:2712834).Curated1
Sequence conflicti116A → R in AAA60022 (PubMed:2712834).Curated1
Sequence conflicti139Q → E in CAA37673 (PubMed:2395659).Curated1
Sequence conflicti157P → R in CAA37673 (PubMed:2395659).Curated1
Sequence conflicti212P → A in CAA36422 (PubMed:2842184).Curated1
Sequence conflicti215C → S in AAA60022 (PubMed:2712834).Curated1
Sequence conflicti294S → T in AAA60022 (PubMed:2712834).Curated1
Sequence conflicti372C → V in AAA60022 (PubMed:2712834).Curated1
Sequence conflicti383D → N in CAA37673 (PubMed:2395659).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04796015S → N1 PublicationCorresponds to variant dbSNP:rs17850347Ensembl.1
Natural variantiVAR_047961124F → V1 PublicationCorresponds to variant dbSNP:rs17856254Ensembl.1
Natural variantiVAR_047962226W → R1 PublicationCorresponds to variant dbSNP:rs17856253Ensembl.1
Natural variantiVAR_047963330Y → H1 PublicationCorresponds to variant dbSNP:rs17851392Ensembl.1
Natural variantiVAR_047964360V → A1 PublicationCorresponds to variant dbSNP:rs17850198Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_053360153 – 185Missing in isoform 3. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_036023380 – 386GTEDSTD → VLKVIFAVAFCLISAVLMVL LFIHIRRGLCWQRESYGNI in isoform 2. 1 Publication7

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M97589 M97588 Genomic DNA Translation: AAA60021.1
M34840 mRNA Translation: AAA69694.1
M24902 mRNA Translation: AAA60022.1
X52174 mRNA Translation: CAA36422.1
X53605 mRNA Translation: CAA37673.1
U07097 U07095 Genomic DNA Translation: AAB60640.1
AB102888 mRNA Translation: BAD89417.1
AK300540 mRNA Translation: BAG62248.1
AC020633 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW79203.1
CH471052 Genomic DNA Translation: EAW79205.1
BC007460 mRNA Translation: AAH07460.1
BC008493 mRNA Translation: AAH08493.1
BC016344 mRNA Translation: AAH16344.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS3073.1 [P15309-1]
CCDS46916.1 [P15309-2]
CCDS77818.1 [P15309-3]

Protein sequence database of the Protein Information Resource

More...PIRi		JH0610

NCBI Reference Sequences

More...RefSeqi		NP_001090.2, NM_001099.4 [P15309-1]
NP_001127666.1, NM_001134194.1 [P15309-2]
NP_001278966.1, NM_001292037.1 [P15309-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000336375; ENSP00000337471; ENSG00000014257 [P15309-1]
ENST00000351273; ENSP00000323036; ENSG00000014257 [P15309-2]
ENST00000475741; ENSP00000417744; ENSG00000014257 [P15309-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		55

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:55

UCSC genome browser

More...UCSCi		uc003eon.4, human [P15309-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M97589 M97588 Genomic DNA Translation: AAA60021.1
M34840 mRNA Translation: AAA69694.1
M24902 mRNA Translation: AAA60022.1
X52174 mRNA Translation: CAA36422.1
X53605 mRNA Translation: CAA37673.1
U07097 U07095 Genomic DNA Translation: AAB60640.1
AB102888 mRNA Translation: BAD89417.1
AK300540 mRNA Translation: BAG62248.1
AC020633 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW79203.1
CH471052 Genomic DNA Translation: EAW79205.1
BC007460 mRNA Translation: AAH07460.1
BC008493 mRNA Translation: AAH08493.1
BC016344 mRNA Translation: AAH16344.1
CCDSiCCDS3073.1 [P15309-1]
CCDS46916.1 [P15309-2]
CCDS77818.1 [P15309-3]
PIRiJH0610
RefSeqiNP_001090.2, NM_001099.4 [P15309-1]
NP_001127666.1, NM_001134194.1 [P15309-2]
NP_001278966.1, NM_001292037.1 [P15309-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CVIX-ray3.20A/B/C/D33-374[»]
1ND5X-ray2.90A/B/C/D33-386[»]
1ND6X-ray2.40A/B/C/D33-386[»]
2HPAX-ray2.90A/B/C/D33-374[»]
2L3HNMR-A248-286[»]
2L77NMR-A248-286[»]
2L79NMR-A248-286[»]
2MG0NMR-A262-270[»]
3PPDX-ray1.50A260-265[»]
BMRBiP15309
SMRiP15309
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi106571, 80 interactors
ComplexPortaliCPX-120, Prostatic acid phosphatase complex
IntActiP15309, 22 interactors
MINTiP15309
STRINGi9606.ENSP00000323036

Chemistry databases

BindingDBiP15309
ChEMBLiCHEMBL2633
DrugBankiDB03390, (2R,3R)-2,3-Dihydroxy-4-oxo-4-(propylamino)butanoic acid
DB03577, Alpha-Benzyl-Aminobenzyl-Phosphonic Acid
DB06688, Sipuleucel-T
DrugCentraliP15309
SwissLipidsiSLP:000001295 [P15309-1]

PTM databases

DEPODiACPP
GlyConnecti2001, 6 N-Linked glycans (2 sites)
GlyGeniP15309, 3 sites, 14 N-linked glycans (2 sites)
iPTMnetiP15309
PhosphoSitePlusiP15309

Genetic variation databases

BioMutaiACPP
DMDMi130730

Proteomic databases

EPDiP15309
jPOSTiP15309
MassIVEiP15309
MaxQBiP15309
PaxDbiP15309
PeptideAtlasiP15309
PRIDEiP15309
ProteomicsDBi53126 [P15309-1]
53127 [P15309-2]
62789

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1343, 922 antibodies

The DNASU plasmid repository

More...DNASUi		55

Genome annotation databases

EnsembliENST00000336375; ENSP00000337471; ENSG00000014257 [P15309-1]
ENST00000351273; ENSP00000323036; ENSG00000014257 [P15309-2]
ENST00000475741; ENSP00000417744; ENSG00000014257 [P15309-3]
GeneIDi55
KEGGihsa:55
UCSCiuc003eon.4, human [P15309-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		55
DisGeNETi55

GeneCards: human genes, protein and diseases

More...GeneCardsi		ACP3
HGNCiHGNC:125, ACP3
HPAiENSG00000014257, Tissue enriched (prostate)
MIMi171790, gene
neXtProtiNX_P15309
OpenTargetsiENSG00000014257
PharmGKBiPA24449
VEuPathDBiHostDB:ENSG00000014257.15

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3720, Eukaryota
GeneTreeiENSGT00940000160450
HOGENOMiCLU_030431_1_1_1
InParanoidiP15309
OMAiCEGVHNF
OrthoDBi1221585at2759
PhylomeDBiP15309
TreeFamiTF312893

Enzyme and pathway databases

BRENDAi3.1.3.2, 2681
PathwayCommonsiP15309
ReactomeiR-HSA-6798695, Neutrophil degranulation
SABIO-RKiP15309

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		55, 4 hits in 868 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ACPP, human
EvolutionaryTraceiP15309

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Prostatic_acid_phosphatase

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		55
PharosiP15309, Tchem

Protein Ontology

More...PROi		PR:P15309
RNActiP15309, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000014257, Expressed in prostate gland and 163 other tissues
ExpressionAtlasiP15309, baseline and differential
GenevisibleiP15309, HS

Family and domain databases

CDDicd07061, HP_HAP_like, 1 hit
DisProtiDP00628
Gene3Di3.40.50.1240, 1 hit
InterProiView protein in InterPro
IPR033379, Acid_Pase_AS
IPR000560, His_Pase_clade-2
IPR029033, His_PPase_superfam
PfamiView protein in Pfam
PF00328, His_Phos_2, 1 hit
SUPFAMiSSF53254, SSF53254, 1 hit
PROSITEiView protein in PROSITE
PS00616, HIS_ACID_PHOSPHAT_1, 1 hit
PS00778, HIS_ACID_PHOSPHAT_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPPAP_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P15309
Secondary accession number(s): D3DNC6
, Q5FBY0, Q96KY0, Q96QK9, Q96QM0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: March 1, 1992
Last modified: February 10, 2021
This is version 194 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human variants curated from literature reports
    Index of human variants curated from literature reports
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  6. Human entries with genetic variants
    List of human entries with genetic variants
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again