Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P14678 (RSMB_HUMAN)

Entry version 220 (13 Nov 2019)
Sequence version 2 (01 Nov 1991)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Small nuclear ribonucleoprotein-associated proteins B and B'

Gene

SNRPB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays role in pre-mRNA splicing as core component of the SMN-Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed:11991638, PubMed:18984161, PubMed:19325628, PubMed:25555158, PubMed:26912367, PubMed:28502770, PubMed:28781166, PubMed:28076346). Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes (PubMed:11991638, PubMed:28502770, PubMed:28781166, PubMed:28076346). Is also a component of the minor U12 spliceosome (PubMed:15146077). As part of the U7 snRNP it is involved in histone pre-mRNA 3'-end processing (PubMed:12975319).10 Publications

Miscellaneous

Patients with the autoimmune disease systemic lupus erythematosus (SLE) have autoantibodies directed against some of the individual snRNP polypeptides. The most common autoantigen is called Sm. B/b' bear Sm epitopes.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRibonucleoprotein, RNA-binding
Biological processmRNA processing, mRNA splicing

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-111367 SLBP independent Processing of Histone Pre-mRNAs
R-HSA-191859 snRNP Assembly
R-HSA-72163 mRNA Splicing - Major Pathway
R-HSA-72165 mRNA Splicing - Minor Pathway
R-HSA-73856 RNA Polymerase II Transcription Termination
R-HSA-77588 SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Small nuclear ribonucleoprotein-associated proteins B and B'
Short name:
snRNP-B
Alternative name(s):
Sm protein B/B'
Short name:
Sm-B/B'
Short name:
SmB/B'
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SNRPB
Synonyms:COD, SNRPB1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:11153 SNRPB

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		182282 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P14678

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus, Spliceosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Cerebrocostomandibular syndrome (CCMS)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA syndrome characterized by severe micrognathia, rib defects ranging from a few dorsal rib segments to complete absence of ossification, and mental retardation.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07338055N → S in CCMS; expression of the protein is reduced. 2 Publications1
Natural variantiVAR_07338155N → T in CCMS. 1 Publication1
Natural variantiVAR_07338256S → R in CCMS. 2 Publications1
Natural variantiVAR_07338356S → W in CCMS. 1 Publication1

Keywords - Diseasei

Disease mutation, Mental retardation

Organism-specific databases

DisGeNET

More...DisGeNETi		6628

MalaCards human disease database

More...MalaCardsi		SNRPB
MIMi117650 phenotype

Open Targets

More...OpenTargetsi		ENSG00000125835

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		1393 Cerebrocostomandibular syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA35995

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P14678

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SNRPB

Domain mapping of disease mutations (DMDM)

More...DMDMi		134037

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001255171 – 240Small nuclear ribonucleoprotein-associated proteins B and B'Add BLAST240

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei108Asymmetric dimethylarginine; alternateCombined sources1
Modified residuei108Dimethylated arginine; in A2780 ovarian carcinoma cell line1 Publication1
Modified residuei108Omega-N-methylarginine; alternateCombined sources1
Modified residuei112Asymmetric dimethylarginine; alternateCombined sources1
Modified residuei112Dimethylated arginine; in A2780 ovarian carcinoma cell line1 Publication1
Modified residuei112Omega-N-methylarginine; alternateCombined sources1
Modified residuei147Omega-N-methylarginine1 Publication1
Modified residuei172Omega-N-methylarginineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Methylated. Arg-108 and Arg-112 are dimethylated, probably to asymmetric dimethylarginine.2 Publications

Keywords - PTMi

Methylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P14678

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P14678

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P14678

MaxQB - The MaxQuant DataBase

More...MaxQBi		P14678

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P14678

PeptideAtlas

More...PeptideAtlasi		P14678

PRoteomics IDEntifications database

More...PRIDEi		P14678

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		53074 [P14678-1]
53075 [P14678-2]
53076 [P14678-3]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		P14678-2 [P14678-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P14678

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P14678

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P14678

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000125835 Expressed in 228 organ(s), highest expression level in bone marrow

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P14678 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P14678 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB009610
HPA003482
HPA067842

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed:11991638, PubMed:10025403, PubMed:19325628, PubMed:21516107, PubMed:25555158, PubMed:26912367, PubMed:28502770, PubMed:28781166, PubMed:28076346). Most spliceosomal snRNPs contain a common set of Sm proteins, SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP (PubMed:10025403, PubMed:19325628, PubMed:21516107, PubMed:25555158, PubMed:26912367, PubMed:28502770, PubMed:28781166, PubMed:28076346).

Component of the U1 snRNP (PubMed:19325628, PubMed:25555158). The U1 snRNP is composed of the U1 snRNA and the 7 core Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG, and at least three U1 snRNP-specific proteins SNRNP70/U1-70K, SNRPA/U1-A and SNRPC/U1-C (PubMed:19325628, PubMed:25555158).

Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, SNRNP40, SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF, SNRPG, DDX23, CD2BP2, PPIH, SNU13, EFTUD2, SART1 and USP39, plus LSM2, LSM3, LSM4, LSM5, LSM6, LSM7 and LSM8 (PubMed:26912367).

Component of the U7 snRNP complex, or U7 Sm protein core complex, that is composed of the U7 snRNA and at least LSM10, LSM11, SNRPB, SNRPD3, SNRPE, SNRPF and SNRPG; the complex does not contain SNRPD1 and SNRPD2 (PubMed:11574479, PubMed:12975319).

Component of the U11/U12 snRNPs that are part of the U12-type spliceosome (PubMed:15146077). Part of the SMN-Sm complex that contains SMN1, GEMIN2/SIP1, DDX20/GEMIN3, GEMIN4, GEMIN5, GEMIN6, GEMIN7, GEMIN8, STRAP/UNRIP and the Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG; catalyzes core snRNPs assembly (PubMed:12095920, PubMed:18984161).

Forms a 6S pICln-Sm complex composed of CLNS1A/pICln, SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG; ring-like structure where CLNS1A/pICln mimics additional Sm proteins and which is unable to assemble into the core snRNP (PubMed:18984161).

Identified in a histone pre-mRNA complex, at least composed of ERI1, LSM11, SLBP, SNRPB, SYNCRIP and YBX1 (By similarity).

Interacts with TDRD3 and SNUPN (PubMed:12095920, PubMed:15955813).

By similarity16 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		112512, 180 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P14678

Database of interacting proteins

More...DIPi		DIP-31239N

Protein interaction database and analysis system

More...IntActi		P14678, 124 interactors

Molecular INTeraction database

More...MINTi		P14678

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000412566

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1240
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P14678

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P14678

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati175 – 1817
Repeati191 – 1966
Repeati216 – 2216
Repeati222 – 2287
Repeati230 – 2367

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni175 – 236Repeat-rich regionAdd BLAST62

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the snRNP SmB/SmN family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3168 Eukaryota
COG1958 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155052

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000188899

KEGG Orthology (KO)

More...KOi		K11086

Identification of Orthologs from Complete Genome Data

More...OMAi		RGMGMMP

Database of Orthologous Groups

More...OrthoDBi		1630470at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P14678

TreeFam database of animal gene trees

More...TreeFami		TF314232

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001163 LSM_dom_euk/arc
IPR010920 LSM_dom_sf
IPR017131 snRNP-assoc_SmB/SmN

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01423 LSM, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF037187 snRNP_SmB/SmN, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00651 Sm, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50182 SSF50182, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform SM-B' (identifier: P14678-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTVGKSSKML QHIDYRMRCI LQDGRIFIGT FKAFDKHMNL ILCDCDEFRK 
        60         70         80         90        100
IKPKNSKQAE REEKRVLGLV LLRGENLVSM TVEGPPPKDT GIARVPLAGA 
       110        120        130        140        150
AGGPGIGRAA GRGIPAGVPM PQAPAGLAGP VRGVGGPSQQ VMTPQGRGTV 
       160        170        180        190        200
AAAAAAATAS IAGAPTQYPP GRGGPPPPMG RGAPPPGMMG PPPGMRPPMG 
       210        220        230        240
PPMGIPPGRG TPMGMPPPGM RPPPPGMRGP PPPGMRPPRP
Length:240
Mass (Da):24,610
Last modified:November 1, 1991 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF2E1D5E11A601170
GO
Isoform SM-B (identifier: P14678-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     230-240: PPPPGMRPPRP → LL

Show »
Length:231
Mass (Da):23,656
Checksum:i5CB0BB2E75B93D4A
GO
Isoform SM-B1 (identifier: P14678-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-228: MR → GCEAFFDPWPQSMEVAPQRRGLDSSGPRYHRPVCFLCCCSWSLMGLSGFLT

Show »
Length:289
Mass (Da):30,032
Checksum:i573E8A21414E2C22
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R3P3S4R3P3_HUMAN
Small nuclear ribonucleoprotein-ass...
SNRPB
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD54488 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti172 – 173RG → L no nucleotide entry (PubMed:2524838).Curated2
Sequence conflicti201Missing no nucleotide entry (PubMed:2524838).Curated1
Sequence conflicti217 – 218PP → S no nucleotide entry (PubMed:2524838).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07338055N → S in CCMS; expression of the protein is reduced. 2 Publications1
Natural variantiVAR_07338155N → T in CCMS. 1 Publication1
Natural variantiVAR_07338256S → R in CCMS. 2 Publications1
Natural variantiVAR_07338356S → W in CCMS. 1 Publication1
Natural variantiVAR_05227479S → P. Corresponds to variant dbSNP:rs11545672Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_012221227 – 228MR → GCEAFFDPWPQSMEVAPQRR GLDSSGPRYHRPVCFLCCCS WSLMGLSGFLT in isoform SM-B1. 1 Publication2
Alternative sequenceiVSP_005914230 – 240PPPPGMRPPRP → LL in isoform SM-B. 3 PublicationsAdd BLAST11

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X17567 mRNA Translation: CAB57867.1
X17568 mRNA Translation: CAB57868.1
X15893 mRNA Translation: CAA33902.1
AF134825
, AF134822, AF134823, AF134824 Genomic DNA Translation: AAD54488.1 Sequence problems.
AL049650 Genomic DNA Translation: CAB46715.1
CH471133 Genomic DNA Translation: EAX10596.1
CR456969 mRNA Translation: CAG33250.1
AL049650 Genomic DNA Translation: CAB46714.1
M34081 mRNA Translation: AAA36578.1
M34082 mRNA Translation: AAA36579.1
X52979 Genomic DNA Translation: CAA37170.1
X52979 Genomic DNA Translation: CAA37171.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS13026.1 [P14678-1]
CCDS13027.1 [P14678-2]

Protein sequence database of the Protein Information Resource

More...PIRi		S09377

NCBI Reference Sequences

More...RefSeqi		NP_003082.1, NM_003091.3 [P14678-2]
NP_937859.1, NM_198216.1 [P14678-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000381342; ENSP00000370746; ENSG00000125835 [P14678-2]
ENST00000438552; ENSP00000412566; ENSG00000125835 [P14678-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		6628

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:6628

UCSC genome browser

More...UCSCi		uc002wfz.2 human [P14678-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X17567 mRNA Translation: CAB57867.1
X17568 mRNA Translation: CAB57868.1
X15893 mRNA Translation: CAA33902.1
AF134825
, AF134822, AF134823, AF134824 Genomic DNA Translation: AAD54488.1 Sequence problems.
AL049650 Genomic DNA Translation: CAB46715.1
CH471133 Genomic DNA Translation: EAX10596.1
CR456969 mRNA Translation: CAG33250.1
AL049650 Genomic DNA Translation: CAB46714.1
M34081 mRNA Translation: AAA36578.1
M34082 mRNA Translation: AAA36579.1
X52979 Genomic DNA Translation: CAA37170.1
X52979 Genomic DNA Translation: CAA37171.1
CCDSiCCDS13026.1 [P14678-1]
CCDS13027.1 [P14678-2]
PIRiS09377
RefSeqiNP_003082.1, NM_003091.3 [P14678-2]
NP_937859.1, NM_198216.1 [P14678-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1D3BX-ray2.00B/D/F/H/J/L1-91[»]
3CW1X-ray5.49A/H/I/J1-174[»]
3JCRelectron microscopy7.00O/o1-240[»]
3PGWX-ray4.40B/Q1-229[»]
4PJOX-ray3.30B/P/b/p1-95[»]
4WZJX-ray3.60AA/AH/AO/BA/BH/BO/CA/CH/CO/DA/DH/DO1-95[»]
5MQFelectron microscopy5.90f/m1-240[»]
5O9Zelectron microscopy4.50X/f/m1-240[»]
5XJCelectron microscopy3.60b/i1-229[»]
5YZGelectron microscopy4.10b/i1-229[»]
5Z56electron microscopy5.10b/i1-229[»]
5Z57electron microscopy6.50b/i1-229[»]
5Z58electron microscopy4.90b/i1-229[»]
6AH0electron microscopy5.70U/f/i1-229[»]
6FF7electron microscopy4.50f/m1-240[»]
6ICZelectron microscopy3.00b/i1-229[»]
6ID0electron microscopy2.90b/i1-229[»]
6ID1electron microscopy2.86b/i1-229[»]
6QDVelectron microscopy3.30b/k6-87[»]
6QW6electron microscopy2.924b/5b1-240[»]
6QX9electron microscopy3.281b/2b/4b/5b1-240[»]
SMRiP14678
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi112512, 180 interactors
CORUMiP14678
DIPiDIP-31239N
IntActiP14678, 124 interactors
MINTiP14678
STRINGi9606.ENSP00000412566

PTM databases

iPTMnetiP14678
PhosphoSitePlusiP14678
SwissPalmiP14678

Polymorphism and mutation databases

BioMutaiSNRPB
DMDMi134037

Proteomic databases

EPDiP14678
jPOSTiP14678
MassIVEiP14678
MaxQBiP14678
PaxDbiP14678
PeptideAtlasiP14678
PRIDEiP14678
ProteomicsDBi53074 [P14678-1]
53075 [P14678-2]
53076 [P14678-3]
TopDownProteomicsiP14678-2 [P14678-2]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		6628

Genome annotation databases

EnsembliENST00000381342; ENSP00000370746; ENSG00000125835 [P14678-2]
ENST00000438552; ENSP00000412566; ENSG00000125835 [P14678-1]
GeneIDi6628
KEGGihsa:6628
UCSCiuc002wfz.2 human [P14678-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		6628
DisGeNETi6628

GeneCards: human genes, protein and diseases

More...GeneCardsi		SNRPB
HGNCiHGNC:11153 SNRPB
HPAiCAB009610
HPA003482
HPA067842
MalaCardsiSNRPB
MIMi117650 phenotype
182282 gene
neXtProtiNX_P14678
OpenTargetsiENSG00000125835
Orphaneti1393 Cerebrocostomandibular syndrome
PharmGKBiPA35995

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3168 Eukaryota
COG1958 LUCA
GeneTreeiENSGT00940000155052
HOGENOMiHOG000188899
KOiK11086
OMAiRGMGMMP
OrthoDBi1630470at2759
PhylomeDBiP14678
TreeFamiTF314232

Enzyme and pathway databases

ReactomeiR-HSA-111367 SLBP independent Processing of Histone Pre-mRNAs
R-HSA-191859 snRNP Assembly
R-HSA-72163 mRNA Splicing - Major Pathway
R-HSA-72165 mRNA Splicing - Minor Pathway
R-HSA-73856 RNA Polymerase II Transcription Termination
R-HSA-77588 SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SNRPB human
EvolutionaryTraceiP14678

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		SNRPB

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		6628
PharosiP14678

Protein Ontology

More...PROi		PR:P14678

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000125835 Expressed in 228 organ(s), highest expression level in bone marrow
ExpressionAtlasiP14678 baseline and differential
GenevisibleiP14678 HS

Family and domain databases

InterProiView protein in InterPro
IPR001163 LSM_dom_euk/arc
IPR010920 LSM_dom_sf
IPR017131 snRNP-assoc_SmB/SmN
PfamiView protein in Pfam
PF01423 LSM, 1 hit
PIRSFiPIRSF037187 snRNP_SmB/SmN, 1 hit
SMARTiView protein in SMART
SM00651 Sm, 1 hit
SUPFAMiSSF50182 SSF50182, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRSMB_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P14678
Secondary accession number(s): Q15490, Q6IB35, Q9UIS5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: November 1, 1991
Last modified: November 13, 2019
This is version 220 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again