Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Small nuclear ribonucleoprotein-associated proteins B and B'

Gene

SNRPB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays role in pre-mRNA splicing as core component of the SMN-Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed:11991638, PubMed:18984161, PubMed:19325628, PubMed:25555158, PubMed:26912367, PubMed:28502770, PubMed:28781166, PubMed:28076346). Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes (PubMed:11991638, PubMed:28502770, PubMed:28781166, PubMed:28076346). Is also a component of the minor U12 spliceosome (PubMed:15146077). As part of the U7 snRNP it is involved in histone pre-mRNA 3'-end processing (PubMed:12975319).10 Publications

Miscellaneous

Patients with the autoimmune disease systemic lupus erythematosus (SLE) have autoantibodies directed against some of the individual snRNP polypeptides. The most common autoantigen is called Sm. B/b' bear Sm epitopes.

GO - Molecular functioni

  • histone pre-mRNA DCP binding Source: Ensembl
  • RNA binding Source: BHF-UCL
  • telomerase RNA binding Source: BHF-UCL
  • U2 snRNA binding Source: BHF-UCL

GO - Biological processi

Keywordsi

Molecular functionRibonucleoprotein, RNA-binding
Biological processmRNA processing, mRNA splicing

Enzyme and pathway databases

ReactomeiR-HSA-109688 Cleavage of Growing Transcript in the Termination Region
R-HSA-111367 SLBP independent Processing of Histone Pre-mRNAs
R-HSA-191859 snRNP Assembly
R-HSA-72163 mRNA Splicing - Major Pathway
R-HSA-72165 mRNA Splicing - Minor Pathway
R-HSA-77588 SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs

Names & Taxonomyi

Protein namesi
Recommended name:
Small nuclear ribonucleoprotein-associated proteins B and B'
Short name:
snRNP-B
Alternative name(s):
Sm protein B/B'
Short name:
Sm-B/B'
Short name:
SmB/B'
Gene namesi
Name:SNRPB
Synonyms:COD, SNRPB1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

EuPathDBiHostDB:ENSG00000125835.17
HGNCiHGNC:11153 SNRPB
MIMi182282 gene
neXtProtiNX_P14678

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus, Spliceosome

Pathology & Biotechi

Involvement in diseasei

Cerebrocostomandibular syndrome (CCMS)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA syndrome characterized by severe micrognathia, rib defects ranging from a few dorsal rib segments to complete absence of ossification, and mental retardation.
See also OMIM:117650
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07338055N → S in CCMS; expression of the protein is reduced. 2 Publications1
Natural variantiVAR_07338155N → T in CCMS. 1 Publication1
Natural variantiVAR_07338256S → R in CCMS. 2 Publications1
Natural variantiVAR_07338356S → W in CCMS. 1 Publication1

Keywords - Diseasei

Disease mutation, Mental retardation

Organism-specific databases

DisGeNETi6628
MalaCardsiSNRPB
MIMi117650 phenotype
OpenTargetsiENSG00000125835
Orphaneti1393 Cerebrocostomandibular syndrome
PharmGKBiPA35995

Polymorphism and mutation databases

BioMutaiSNRPB
DMDMi134037

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001255171 – 240Small nuclear ribonucleoprotein-associated proteins B and B'Add BLAST240

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei108Asymmetric dimethylarginine; alternateCombined sources1
Modified residuei108Dimethylated arginine; in A2780 ovarian carcinoma cell line1 Publication1
Modified residuei108Omega-N-methylarginine; alternateCombined sources1
Modified residuei112Asymmetric dimethylarginine; alternateCombined sources1
Modified residuei112Dimethylated arginine; in A2780 ovarian carcinoma cell line1 Publication1
Modified residuei112Omega-N-methylarginine; alternateCombined sources1
Modified residuei147Omega-N-methylarginine1 Publication1
Modified residuei172Omega-N-methylarginineBy similarity1

Post-translational modificationi

Methylated. Arg-108 and Arg-112 are dimethylated, probably to asymmetric dimethylarginine.2 Publications

Keywords - PTMi

Methylation

Proteomic databases

EPDiP14678
MaxQBiP14678
PaxDbiP14678
PeptideAtlasiP14678
PRIDEiP14678
ProteomicsDBi53074
53075 [P14678-2]
53076 [P14678-3]
TopDownProteomicsiP14678-2 [P14678-2]

PTM databases

iPTMnetiP14678
PhosphoSitePlusiP14678
SwissPalmiP14678

Expressioni

Gene expression databases

BgeeiENSG00000125835 Expressed in 228 organ(s), highest expression level in bone marrow
CleanExiHS_SNRPB
ExpressionAtlasiP14678 baseline and differential
GenevisibleiP14678 HS

Organism-specific databases

HPAiCAB009610
HPA003482
HPA067842

Interactioni

Subunit structurei

Core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed:11991638, PubMed:10025403, PubMed:19325628, PubMed:21516107, PubMed:25555158, PubMed:26912367, PubMed:28502770, PubMed:28781166, PubMed:28076346). Most spliceosomal snRNPs contain a common set of Sm proteins, SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP (PubMed:10025403, PubMed:19325628, PubMed:21516107, PubMed:25555158, PubMed:26912367, PubMed:28502770, PubMed:28781166, PubMed:28076346). Component of the U1 snRNP (PubMed:19325628, PubMed:25555158). The U1 snRNP is composed of the U1 snRNA and the 7 core Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG, and at least three U1 snRNP-specific proteins SNRNP70/U1-70K, SNRPA/U1-A and SNRPC/U1-C (PubMed:19325628, PubMed:25555158). Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, SNRNP40, SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF, SNRPG, DDX23, CD2BP2, PPIH, SNU13, EFTUD2, SART1 and USP39, plus LSM2, LSM3, LSM4, LSM5, LSM6, LSM7 and LSM8 (PubMed:26912367). Component of the U7 snRNP complex, or U7 Sm protein core complex, that is composed of the U7 snRNA and at least LSM10, LSM11, SNRPB, SNRPD3, SNRPE, SNRPF and SNRPG; the complex does not contain SNRPD1 and SNRPD2 (PubMed:11574479, PubMed:12975319). Component of the U11/U12 snRNPs that are part of the U12-type spliceosome (PubMed:15146077). Part of the SMN-Sm complex that contains SMN1, GEMIN2/SIP1, DDX20/GEMIN3, GEMIN4, GEMIN5, GEMIN6, GEMIN7, GEMIN8, STRAP/UNRIP and the Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG; catalyzes core snRNPs assembly (PubMed:12095920, PubMed:18984161). Forms a 6S pICln-Sm complex composed of CLNS1A/pICln, SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG; ring-like structure where CLNS1A/pICln mimics additional Sm proteins and which is unable to assemble into the core snRNP (PubMed:18984161). Identified in a histone pre-mRNA complex, at least composed of ERI1, LSM11, SLBP, SNRPB, SYNCRIP and YBX1 (By similarity). Interacts with TDRD3 and SNUPN (PubMed:12095920, PubMed:15955813).By similarity16 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi112512, 166 interactors
CORUMiP14678
DIPiDIP-31239N
IntActiP14678, 111 interactors
MINTiP14678
STRINGi9606.ENSP00000412566

Structurei

Secondary structure

1240
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP14678
SMRiP14678
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP14678

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati175 – 1817
Repeati191 – 1966
Repeati216 – 2216
Repeati222 – 2287
Repeati230 – 2367

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni175 – 236Repeat-rich regionAdd BLAST62

Sequence similaritiesi

Belongs to the snRNP SmB/SmN family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG3168 Eukaryota
COG1958 LUCA
GeneTreeiENSGT00670000098029
HOGENOMiHOG000188899
HOVERGENiHBG001019
KOiK11086
OMAiRGMGMMP
PhylomeDBiP14678
TreeFamiTF314232

Family and domain databases

InterProiView protein in InterPro
IPR001163 LSM_dom_euk/arc
IPR010920 LSM_dom_sf
IPR017131 snRNP-assoc_SmB/SmN
PfamiView protein in Pfam
PF01423 LSM, 1 hit
PIRSFiPIRSF037187 snRNP_SmB/SmN, 1 hit
SMARTiView protein in SMART
SM00651 Sm, 1 hit
SUPFAMiSSF50182 SSF50182, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform SM-B' (identifier: P14678-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTVGKSSKML QHIDYRMRCI LQDGRIFIGT FKAFDKHMNL ILCDCDEFRK
60 70 80 90 100
IKPKNSKQAE REEKRVLGLV LLRGENLVSM TVEGPPPKDT GIARVPLAGA
110 120 130 140 150
AGGPGIGRAA GRGIPAGVPM PQAPAGLAGP VRGVGGPSQQ VMTPQGRGTV
160 170 180 190 200
AAAAAAATAS IAGAPTQYPP GRGGPPPPMG RGAPPPGMMG PPPGMRPPMG
210 220 230 240
PPMGIPPGRG TPMGMPPPGM RPPPPGMRGP PPPGMRPPRP
Length:240
Mass (Da):24,610
Last modified:November 1, 1991 - v2
Checksum:iF2E1D5E11A601170
GO
Isoform SM-B (identifier: P14678-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     230-240: PPPPGMRPPRP → LL

Show »
Length:231
Mass (Da):23,656
Checksum:i5CB0BB2E75B93D4A
GO
Isoform SM-B1 (identifier: P14678-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-228: MR → GCEAFFDPWPQSMEVAPQRRGLDSSGPRYHRPVCFLCCCSWSLMGLSGFLT

Show »
Length:289
Mass (Da):30,032
Checksum:i573E8A21414E2C22
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R3P3S4R3P3_HUMAN
Small nuclear ribonucleoprotein-ass...
SNRPB
70Annotation score:

Sequence cautioni

The sequence AAD54488 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti172 – 173RG → L no nucleotide entry (PubMed:2524838).Curated2
Sequence conflicti201Missing no nucleotide entry (PubMed:2524838).Curated1
Sequence conflicti217 – 218PP → S no nucleotide entry (PubMed:2524838).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07338055N → S in CCMS; expression of the protein is reduced. 2 Publications1
Natural variantiVAR_07338155N → T in CCMS. 1 Publication1
Natural variantiVAR_07338256S → R in CCMS. 2 Publications1
Natural variantiVAR_07338356S → W in CCMS. 1 Publication1
Natural variantiVAR_05227479S → P. Corresponds to variant dbSNP:rs11545672Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_012221227 – 228MR → GCEAFFDPWPQSMEVAPQRR GLDSSGPRYHRPVCFLCCCS WSLMGLSGFLT in isoform SM-B1. 1 Publication2
Alternative sequenceiVSP_005914230 – 240PPPPGMRPPRP → LL in isoform SM-B. 3 PublicationsAdd BLAST11

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X17567 mRNA Translation: CAB57867.1
X17568 mRNA Translation: CAB57868.1
X15893 mRNA Translation: CAA33902.1
AF134825
, AF134822, AF134823, AF134824 Genomic DNA Translation: AAD54488.1 Sequence problems.
AL049650 Genomic DNA Translation: CAB46715.1
CH471133 Genomic DNA Translation: EAX10596.1
CR456969 mRNA Translation: CAG33250.1
AL049650 Genomic DNA Translation: CAB46714.1
M34081 mRNA Translation: AAA36578.1
M34082 mRNA Translation: AAA36579.1
X52979 Genomic DNA Translation: CAA37170.1
X52979 Genomic DNA Translation: CAA37171.1
CCDSiCCDS13026.1 [P14678-1]
CCDS13027.1 [P14678-2]
PIRiS09377
RefSeqiNP_003082.1, NM_003091.3 [P14678-2]
NP_937859.1, NM_198216.1 [P14678-1]
UniGeneiHs.83753

Genome annotation databases

EnsembliENST00000381342; ENSP00000370746; ENSG00000125835 [P14678-2]
ENST00000438552; ENSP00000412566; ENSG00000125835 [P14678-1]
GeneIDi6628
KEGGihsa:6628
UCSCiuc002wfz.2 human [P14678-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X17567 mRNA Translation: CAB57867.1
X17568 mRNA Translation: CAB57868.1
X15893 mRNA Translation: CAA33902.1
AF134825
, AF134822, AF134823, AF134824 Genomic DNA Translation: AAD54488.1 Sequence problems.
AL049650 Genomic DNA Translation: CAB46715.1
CH471133 Genomic DNA Translation: EAX10596.1
CR456969 mRNA Translation: CAG33250.1
AL049650 Genomic DNA Translation: CAB46714.1
M34081 mRNA Translation: AAA36578.1
M34082 mRNA Translation: AAA36579.1
X52979 Genomic DNA Translation: CAA37170.1
X52979 Genomic DNA Translation: CAA37171.1
CCDSiCCDS13026.1 [P14678-1]
CCDS13027.1 [P14678-2]
PIRiS09377
RefSeqiNP_003082.1, NM_003091.3 [P14678-2]
NP_937859.1, NM_198216.1 [P14678-1]
UniGeneiHs.83753

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1D3BX-ray2.00B/D/F/H/J/L1-91[»]
3CW1X-ray5.49A/H/I/J1-174[»]
3JCRelectron microscopy7.00O/o1-240[»]
3PGWX-ray4.40B/Q1-229[»]
4PJOX-ray3.30B/P/b/p1-95[»]
4WZJX-ray3.60AA/AH/AO/BA/BH/BO/CA/CH/CO/DA/DH/DO1-95[»]
5MQFelectron microscopy5.90f/m1-240[»]
5O9Zelectron microscopy4.50X/f/m1-240[»]
5XJCelectron microscopy3.60b/i1-229[»]
5YZGelectron microscopy4.10b/i1-229[»]
5Z56electron microscopy5.10b/i1-229[»]
5Z57electron microscopy6.50b/i1-229[»]
5Z58electron microscopy4.90b/i1-229[»]
ProteinModelPortaliP14678
SMRiP14678
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112512, 166 interactors
CORUMiP14678
DIPiDIP-31239N
IntActiP14678, 111 interactors
MINTiP14678
STRINGi9606.ENSP00000412566

PTM databases

iPTMnetiP14678
PhosphoSitePlusiP14678
SwissPalmiP14678

Polymorphism and mutation databases

BioMutaiSNRPB
DMDMi134037

Proteomic databases

EPDiP14678
MaxQBiP14678
PaxDbiP14678
PeptideAtlasiP14678
PRIDEiP14678
ProteomicsDBi53074
53075 [P14678-2]
53076 [P14678-3]
TopDownProteomicsiP14678-2 [P14678-2]

Protocols and materials databases

DNASUi6628
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000381342; ENSP00000370746; ENSG00000125835 [P14678-2]
ENST00000438552; ENSP00000412566; ENSG00000125835 [P14678-1]
GeneIDi6628
KEGGihsa:6628
UCSCiuc002wfz.2 human [P14678-1]

Organism-specific databases

CTDi6628
DisGeNETi6628
EuPathDBiHostDB:ENSG00000125835.17
GeneCardsiSNRPB
HGNCiHGNC:11153 SNRPB
HPAiCAB009610
HPA003482
HPA067842
MalaCardsiSNRPB
MIMi117650 phenotype
182282 gene
neXtProtiNX_P14678
OpenTargetsiENSG00000125835
Orphaneti1393 Cerebrocostomandibular syndrome
PharmGKBiPA35995
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3168 Eukaryota
COG1958 LUCA
GeneTreeiENSGT00670000098029
HOGENOMiHOG000188899
HOVERGENiHBG001019
KOiK11086
OMAiRGMGMMP
PhylomeDBiP14678
TreeFamiTF314232

Enzyme and pathway databases

ReactomeiR-HSA-109688 Cleavage of Growing Transcript in the Termination Region
R-HSA-111367 SLBP independent Processing of Histone Pre-mRNAs
R-HSA-191859 snRNP Assembly
R-HSA-72163 mRNA Splicing - Major Pathway
R-HSA-72165 mRNA Splicing - Minor Pathway
R-HSA-77588 SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs

Miscellaneous databases

ChiTaRSiSNRPB human
EvolutionaryTraceiP14678
GeneWikiiSNRPB
GenomeRNAii6628
PROiPR:P14678
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000125835 Expressed in 228 organ(s), highest expression level in bone marrow
CleanExiHS_SNRPB
ExpressionAtlasiP14678 baseline and differential
GenevisibleiP14678 HS

Family and domain databases

InterProiView protein in InterPro
IPR001163 LSM_dom_euk/arc
IPR010920 LSM_dom_sf
IPR017131 snRNP-assoc_SmB/SmN
PfamiView protein in Pfam
PF01423 LSM, 1 hit
PIRSFiPIRSF037187 snRNP_SmB/SmN, 1 hit
SMARTiView protein in SMART
SM00651 Sm, 1 hit
SUPFAMiSSF50182 SSF50182, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRSMB_HUMAN
AccessioniPrimary (citable) accession number: P14678
Secondary accession number(s): Q15490, Q6IB35, Q9UIS5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: November 1, 1991
Last modified: November 7, 2018
This is version 211 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again