Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 164 (08 May 2019)
Sequence version 4 (04 Jan 2005)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

cAMP-specific 3',5'-cyclic phosphodiesterase 4D

Gene

Pde4d

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

a divalent metal cationBy similarityNote: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activated by phosphatidic acid (By similarity). Inhibited by rolipram.By similarity1 Publication

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

    1. Vmax=18 pmol/min/mg enzyme for cAMP (in the absence of follicle-stimulating hormone (FSH))1 Publication
    2. Vmax=5 pmol/min/mg enzyme for cAMP (in the presence of follicle-stimulating hormone (FSH))1 Publication

    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: 3',5'-cyclic AMP degradation

    This protein is involved in step 1 of the subpathway that synthesizes AMP from 3',5'-cyclic AMP.
    Proteins known to be involved in this subpathway in this organism are:
    1. cAMP-specific 3',5'-cyclic phosphodiesterase 4B (Pde4b), cAMP-specific 3',5'-cyclic phosphodiesterase 4A (Pde4a), cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A (Pde10a), High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A (Pde7a), cAMP-specific 3',5'-cyclic phosphodiesterase 4C (Pde4c), cAMP-specific 3',5'-cyclic phosphodiesterase 4D (Pde4d)
    This subpathway is part of the pathway 3',5'-cyclic AMP degradation, which is itself part of Purine metabolism.
    View all proteins of this organism that are known to be involved in the subpathway that synthesizes AMP from 3',5'-cyclic AMP, the pathway 3',5'-cyclic AMP degradation and in Purine metabolism.

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei457Proton donorBy similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi461Divalent metal cation 1By similarity1
    Metal bindingi497Divalent metal cation 1By similarity1
    Metal bindingi498Divalent metal cation 1By similarity1
    Metal bindingi498Divalent metal cation 2By similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei498cAMPBy similarity1
    Metal bindingi615Divalent metal cation 1By similarity1
    <p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei618Binds AMP, but not cAMPBy similarity1

    Regions

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi457 – 461cAMPBy similarity5

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionHydrolase
    LigandcAMP, Metal-binding

    Enzyme and pathway databases

    BRENDA Comprehensive Enzyme Information System

    More...
    BRENDAi
    3.1.4.53 5301

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-RNO-180024 DARPP-32 events
    R-RNO-418555 G alpha (s) signalling events

    UniPathway: a resource for the exploration and annotation of metabolic pathways

    More...
    UniPathwayi
    UPA00762;UER00747

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    cAMP-specific 3',5'-cyclic phosphodiesterase 4D (EC:3.1.4.53)
    Alternative name(s):
    DPDE3
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:Pde4d
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

    Organism-specific databases

    Rat genome database

    More...
    RGDi
    3281 Pde4d

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Cytoskeleton, Membrane

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...
    ChEMBLi
    CHEMBL2712

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001988161 – 803cAMP-specific 3',5'-cyclic phosphodiesterase 4DAdd BLAST803

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei137PhosphoserineCombined sources1
    Modified residuei294PhosphoserineBy similarity1
    Modified residuei296PhosphoserineBy similarity1
    Modified residuei343PhosphoserineBy similarity1
    Modified residuei370PhosphoserineBy similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki382Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)By similarity
    Isoform 5 (identifier: P14270-8)
    Modified residuei52PhosphoserineCombined sources1
    Modified residuei56PhosphoserineCombined sources1

    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

    Isoform 1 and isoform 9 are rapidly activated by PKA through phosphorylation. Long isoforms that share a conserved PKA phosphorylation site in the N-terminus are also activated.1 Publication
    Sumoylation of long isoforms by PIAS4 augments their activation by PKA phosphorylation and represses their inhibition by ERK phosphorylation.By similarity

    Keywords - PTMi

    Isopeptide bond, Phosphoprotein, Ubl conjugation

    Proteomic databases

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    P14270

    PRoteomics IDEntifications database

    More...
    PRIDEi
    P14270

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    P14270

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    P14270

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Expressed in epithelial cells. Isoform 33, isoform 4, isoform 5 and isoform 9 are expressed in brain. Isoform 33, isoform 5, isoform 8 and isoform 9 are expressed in heart (at protein level). Isoform 4 and isoform 6 are strongly expressed in cortex and cerebellum. Isoform 7 is strongly expressed in cortex and testis; weakly expressed in kidney, lung, spleen and cerebellum. Isoform 8 is strongly expressed in lung, heart and liver. Isoform 31, isoform 32, isoform 33, isoform 5 and isoform 9 are widely distributed.2 Publications

    <p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

    Up-regulated by cAMP and follicle-stimulating hormone.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSRNOG00000042536 Expressed in 9 organ(s), highest expression level in skeletal muscle tissue

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    P14270 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    P14270 RN

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Homodimer for the long isoforms. Isoforms with truncated N-termini are monomeric. Binds ARRB2. Isoform 33 is part of a ternary complex containing PRKAR2A, PRKAR2B and AKAP9. Identified in a complex composed of RYR1, PDE4D, PKA, FKBP1A and protein phosphatase 1 (PP1) (By similarity). Interacts with PDE4DIP. Isoform 5 interacts (via N-terminal region) with SHANK2 (via proline-rich region); the interaction is increased in a PKA-dependent manner. Isoform 33, isoform 4, isoform 7, isoform 8 and isoform 9 but not isoform 32 and isoform 6 interact with SHANK2. Isoform 31 interacts weakly with SHANK2.By similarity2 Publications

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    GO - Molecular functioni

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    246765, 4 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    P14270, 3 interactors

    Molecular INTeraction database

    More...
    MINTi
    P14270

    STRING: functional protein association networks

    More...
    STRINGi
    10116.ENSRNOP00000067171

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    P14270

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini381 – 710PDEasePROSITE-ProRule annotationAdd BLAST330

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG3689 Eukaryota
    ENOG410XRI7 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000155674

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    P14270

    KEGG Orthology (KO)

    More...
    KOi
    K13293

    Database of Orthologous Groups

    More...
    OrthoDBi
    904682at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    P14270

    Family and domain databases

    Conserved Domains Database

    More...
    CDDi
    cd00077 HDc, 1 hit

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    1.10.1300.10, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR003607 HD/PDEase_dom
    IPR040844 PDE4_UCR
    IPR023088 PDEase
    IPR002073 PDEase_catalytic_dom
    IPR036971 PDEase_catalytic_dom_sf
    IPR023174 PDEase_CS

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF18100 PDE4_UCR, 1 hit
    PF00233 PDEase_I, 1 hit

    Protein Motif fingerprint database; a protein domain database

    More...
    PRINTSi
    PR00387 PDIESTERASE1

    PROSITE; a protein domain and family database

    More...
    PROSITEi
    View protein in PROSITE
    PS00126 PDEASE_I_1, 1 hit
    PS51845 PDEASE_I_2, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 9 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

    Isoform 4 (identifier: P14270-5) [UniParc]FASTAAdd to basket
    Also known as: PDE4D4

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MEAEGSSVPA RAGSHEGSDS SGGAALKAPK HLWRHEQHHQ YPLRQPQFRL
    60 70 80 90 100
    LHPHHHLPPP PPPSPQPQLQ PPPPPPLPPP PPPPGATRGR YASSGASRVR
    110 120 130 140 150
    HRGYSDTERY LYCRAMDRTS YAVETGHRPG LKKSRMSWPS SFQGLRRFDV
    160 170 180 190 200
    DNGTSAGRSP LDPMTSPGSG LILQANFVHS QRRESFLYRS DSDYDLSPKS
    210 220 230 240 250
    MSRNSSIASD IHGDDLIVTP FAQVLASLRT VRNNFAALTN LQDRAPSKRS
    260 270 280 290 300
    PMCNQPSINK ATITEEAYQK LASETLEELD WCLDQLETLQ TRHSVSEMAS
    310 320 330 340 350
    NKFKRMLNRE LTHLSEMSRS GNQVSEYISN TFLDKQHEVE IPSPTQKEKE
    360 370 380 390 400
    KKKRPMSQIS GVKKLMHSSS LTNSCIPRFG VKTEQEDVLA KELEDVNKWG
    410 420 430 440 450
    LHVFRIAELS GNRPLTVIMH TIFQERDLLK TFKIPVDTLI TYLMTLEDHY
    460 470 480 490 500
    HADVAYHNNI HAADVVQSTH VLLSTPALEA VFTDLEILAA IFASAIHDVD
    510 520 530 540 550
    HPGVSNQFLI NTNSELALMY NDSSVLENHH LAVGFKLLQE ENCDIFQNLT
    560 570 580 590 600
    KKQRQSLRKM AIDIVLATDM SKHMNLLADL KTMVETKKVT SSGVLLLDNY
    610 620 630 640 650
    SDRIQVLQNM VHCADLSNPT KPLQLYRQWT DRIMEEFFRQ GDRERERGME
    660 670 680 690 700
    ISPMCDKHNA SVEKSQVGFI DYIVHPLWET WADLVHPDAQ DILDTLEDNR
    710 720 730 740 750
    EWYQSTIPQS PSPAPDDQED GRQGQTEKFQ FELTLEEDGE SDTEKDSGSQ
    760 770 780 790 800
    VEEDTSCSDS KTLCTQDSES TEIPLDEQVE EEAVAEEESQ PQTGVADDCC

    PDT
    Length:803
    Mass (Da):90,552
    Last modified:January 4, 2005 - v4
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i13E28B257556496D
    GO
    Isoform 33 (identifier: P14270-1) [UniParc]FASTAAdd to basket
    Also known as: PDE4D3, PDE3.3

    The sequence of this isoform differs from the canonical sequence as follows:
         1-131: Missing.
         132-147: KKSRMSWPSSFQGLRR → MMHVNTFPFRRHSWIC

    Show »
    Length:672
    Mass (Da):76,263
    Checksum:i63CE38FA654A0BDD
    GO
    Isoform 31 (identifier: P14270-2) [UniParc]FASTAAdd to basket
    Also known as: PDE3.1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-264: MEAEGSSVPA...QPSINKATIT → MKEQPSCAGT...TESPFPCLFA

    Show »
    Length:584
    Mass (Da):66,243
    Checksum:i7C0DAEB75774F2F8
    GO
    Isoform 32 (identifier: P14270-3) [UniParc]FASTAAdd to basket
    Also known as: PDE3.2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-297: Missing.

    Show »
    Length:506
    Mass (Da):57,601
    Checksum:i7DCA5A564384FC34
    GO
    Isoform 5 (identifier: P14270-8) [UniParc]FASTAAdd to basket
    Also known as: PDE4D5

    The sequence of this isoform differs from the canonical sequence as follows:
         1-147: MEAEGSSVPA...WPSSFQGLRR → MAQQTTSPDT...QRRFTVAHTC

    Show »
    Length:745
    Mass (Da):84,335
    Checksum:i09DEADF7223F77BF
    GO
    Isoform 6 (identifier: P14270-7) [UniParc]FASTAAdd to basket
    Also known as: PDE4D6

    The sequence of this isoform differs from the canonical sequence as follows:
         1-286: Missing.
         287-301: ETLQTRHSVSEMASN → MPEANYLLSVSWGYI

    Show »
    Length:517
    Mass (Da):58,923
    Checksum:i251BF853D7CE6870
    GO
    Isoform 7 (identifier: P14270-4) [UniParc]FASTAAdd to basket
    Also known as: PDE4D7

    The sequence of this isoform differs from the canonical sequence as follows:
         1-56: Missing.
         57-147: LPPPPPPSPQ...WPSSFQGLRR → MERNTCDVLS...IAVTSADSTG

    Show »
    Length:747
    Mass (Da):84,430
    Checksum:iD63B9EF50AA3EFC9
    GO
    Isoform 8 (identifier: P14270-9) [UniParc]FASTAAdd to basket
    Also known as: PDE4D8

    The sequence of this isoform differs from the canonical sequence as follows:
         1-147: MEAEGSSVPA...WPSSFQGLRR → MAFVWDPLGVTVPGPSPRTRTRLRFSKSYS

    Show »
    Length:686
    Mass (Da):77,611
    Checksum:iD1F73EAEBDC6AA66
    GO
    Isoform 9 (identifier: P14270-6) [UniParc]FASTAAdd to basket
    Also known as: PDE4D9

    The sequence of this isoform differs from the canonical sequence as follows:
         1-125: Missing.
         126-147: GHRPGLKKSRMSWPSSFQGLRR → MSIIMKPRSRSTSSLRTTEAVC

    Show »
    Length:678
    Mass (Da):76,656
    Checksum:iE3069D16ADEBEC6C
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    A0A140TAB1A0A140TAB1_RAT
    Phosphodiesterase
    Pde4d
    733Annotation score:

    Annotation score:4 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti226A → N in AAA56857 (PubMed:7958996).Curated1
    Sequence conflicti357S → P in AAQ90405 (Ref. 8) Curated1
    Sequence conflicti480 – 486Missing in AAA18924 (PubMed:8276818).Curated7
    Sequence conflicti480 – 486Missing in AAA18925 (PubMed:8276818).Curated7
    Sequence conflicti641G → E in AAC26969 (PubMed:7958996).Curated1
    Sequence conflicti757C → Y in AAA56857 (PubMed:7958996).Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0045821 – 297Missing in isoform 32. 1 PublicationAdd BLAST297
    Alternative sequenceiVSP_0124041 – 286Missing in isoform 6. 1 PublicationAdd BLAST286
    Alternative sequenceiVSP_0045811 – 264MEAEG…KATIT → MKEQPSCAGTGHPSMAGYGR MAPFELAGGPVKRLRTESPF PCLFA in isoform 31. 3 PublicationsAdd BLAST264
    Alternative sequenceiVSP_0534851 – 147MEAEG…QGLRR → MAQQTTSPDTLTVPEVDNPH VPNPWLNEDLVKSLRENLLQ HEKSKTARKSVSPKLSPVIS PRNSPRLLRRMLLSSNIPKQ RRFTVAHTC in isoform 5. 1 PublicationAdd BLAST147
    Alternative sequenceiVSP_0534861 – 147MEAEG…QGLRR → MAFVWDPLGVTVPGPSPRTR TRLRFSKSYS in isoform 8. 1 PublicationAdd BLAST147
    Alternative sequenceiVSP_0123981 – 131Missing in isoform 33. 2 PublicationsAdd BLAST131
    Alternative sequenceiVSP_0124021 – 125Missing in isoform 9. 1 PublicationAdd BLAST125
    Alternative sequenceiVSP_0124001 – 56Missing in isoform 7. 1 PublicationAdd BLAST56
    Alternative sequenceiVSP_01240157 – 147LPPPP…QGLRR → MERNTCDVLSRSKSASEETL HSCNDEEDPFRGMEPYLVRR LSSRSIQLPPLAFRQLEQTD LRSESENIPRPTSLPLKILP LIAVTSADSTG in isoform 7. 1 PublicationAdd BLAST91
    Alternative sequenceiVSP_012403126 – 147GHRPG…QGLRR → MSIIMKPRSRSTSSLRTTEA VC in isoform 9. 1 PublicationAdd BLAST22
    Alternative sequenceiVSP_012399132 – 147KKSRM…QGLRR → MMHVNTFPFRRHSWIC in isoform 33. 2 PublicationsAdd BLAST16
    Alternative sequenceiVSP_012405287 – 301ETLQT…EMASN → MPEANYLLSVSWGYI in isoform 6. 1 PublicationAdd BLAST15

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    U09455 mRNA Translation: AAA20401.1
    U09457 mRNA Translation: AAB81869.1
    U09456 mRNA Translation: AAA20393.1
    U01280
    , U01278, U01282, U01283, U01284, U01285, U01286, U01287, U01279 Unassigned DNA Translation: AAA18925.1
    U01280
    , U01278, U01282, U01283, U01284, U01285, U01286, U01287, U01279 Unassigned DNA Translation: AAA18924.1
    AF031373 mRNA Translation: AAB95266.1
    AF536974 mRNA Translation: AAN10116.1
    EF102484 mRNA Translation: ABK97408.1
    EF121818 mRNA Translation: ABL14108.1
    AF536979 mRNA Translation: AAN10121.1
    AY388961 mRNA Translation: AAQ90405.1
    AABR06012736 Genomic DNA No translation available.
    AABR06012737 Genomic DNA No translation available.
    AABR06012738 Genomic DNA No translation available.
    AABR06012739 Genomic DNA No translation available.
    AABR06012740 Genomic DNA No translation available.
    AABR06012741 Genomic DNA No translation available.
    AABR06012742 Genomic DNA No translation available.
    AABR06012743 Genomic DNA No translation available.
    AABR06012744 Genomic DNA No translation available.
    AABR06012745 Genomic DNA No translation available.
    AABR06012746 Genomic DNA No translation available.
    AABR06012747 Genomic DNA No translation available.
    AABR06012748 Genomic DNA No translation available.
    AABR06012749 Genomic DNA No translation available.
    AABR06012750 Genomic DNA No translation available.
    AABR06012751 Genomic DNA No translation available.
    AABR06012752 Genomic DNA No translation available.
    AABR06012753 Genomic DNA No translation available.
    AABR06012754 Genomic DNA No translation available.
    AABR06012755 Genomic DNA No translation available.
    AABR06012756 Genomic DNA No translation available.
    AABR06012757 Genomic DNA No translation available.
    AABR06012758 Genomic DNA No translation available.
    AABR06012759 Genomic DNA No translation available.
    AABR06012760 Genomic DNA No translation available.
    L27059 mRNA Translation: AAA56857.1
    L27060 mRNA Translation: AAC26969.1

    Protein sequence database of the Protein Information Resource

    More...
    PIRi
    B53109
    I61259

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001106799.1, NM_001113328.1
    NP_001106800.1, NM_001113329.1 [P14270-4]
    NP_001106803.1, NM_001113332.1 [P14270-8]
    NP_001106805.1, NM_001113334.1 [P14270-9]
    NP_058728.1, NM_017032.1 [P14270-1]
    XP_008758943.1, XM_008760721.1 [P14270-6]
    XP_008758944.1, XM_008760722.2 [P14270-7]
    XP_008758945.1, XM_008760723.1 [P14270-3]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENSRNOT00000066384; ENSRNOP00000063446; ENSRNOG00000042536 [P14270-9]
    ENSRNOT00000067546; ENSRNOP00000062384; ENSRNOG00000042536 [P14270-7]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    24627

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    rno:24627

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    U09455 mRNA Translation: AAA20401.1
    U09457 mRNA Translation: AAB81869.1
    U09456 mRNA Translation: AAA20393.1
    U01280
    , U01278, U01282, U01283, U01284, U01285, U01286, U01287, U01279 Unassigned DNA Translation: AAA18925.1
    U01280
    , U01278, U01282, U01283, U01284, U01285, U01286, U01287, U01279 Unassigned DNA Translation: AAA18924.1
    AF031373 mRNA Translation: AAB95266.1
    AF536974 mRNA Translation: AAN10116.1
    EF102484 mRNA Translation: ABK97408.1
    EF121818 mRNA Translation: ABL14108.1
    AF536979 mRNA Translation: AAN10121.1
    AY388961 mRNA Translation: AAQ90405.1
    AABR06012736 Genomic DNA No translation available.
    AABR06012737 Genomic DNA No translation available.
    AABR06012738 Genomic DNA No translation available.
    AABR06012739 Genomic DNA No translation available.
    AABR06012740 Genomic DNA No translation available.
    AABR06012741 Genomic DNA No translation available.
    AABR06012742 Genomic DNA No translation available.
    AABR06012743 Genomic DNA No translation available.
    AABR06012744 Genomic DNA No translation available.
    AABR06012745 Genomic DNA No translation available.
    AABR06012746 Genomic DNA No translation available.
    AABR06012747 Genomic DNA No translation available.
    AABR06012748 Genomic DNA No translation available.
    AABR06012749 Genomic DNA No translation available.
    AABR06012750 Genomic DNA No translation available.
    AABR06012751 Genomic DNA No translation available.
    AABR06012752 Genomic DNA No translation available.
    AABR06012753 Genomic DNA No translation available.
    AABR06012754 Genomic DNA No translation available.
    AABR06012755 Genomic DNA No translation available.
    AABR06012756 Genomic DNA No translation available.
    AABR06012757 Genomic DNA No translation available.
    AABR06012758 Genomic DNA No translation available.
    AABR06012759 Genomic DNA No translation available.
    AABR06012760 Genomic DNA No translation available.
    L27059 mRNA Translation: AAA56857.1
    L27060 mRNA Translation: AAC26969.1
    PIRiB53109
    I61259
    RefSeqiNP_001106799.1, NM_001113328.1
    NP_001106800.1, NM_001113329.1 [P14270-4]
    NP_001106803.1, NM_001113332.1 [P14270-8]
    NP_001106805.1, NM_001113334.1 [P14270-9]
    NP_058728.1, NM_017032.1 [P14270-1]
    XP_008758943.1, XM_008760721.1 [P14270-6]
    XP_008758944.1, XM_008760722.2 [P14270-7]
    XP_008758945.1, XM_008760723.1 [P14270-3]

    3D structure databases

    SMRiP14270
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi246765, 4 interactors
    IntActiP14270, 3 interactors
    MINTiP14270
    STRINGi10116.ENSRNOP00000067171

    Chemistry databases

    ChEMBLiCHEMBL2712

    PTM databases

    iPTMnetiP14270
    PhosphoSitePlusiP14270

    Proteomic databases

    PaxDbiP14270
    PRIDEiP14270

    Protocols and materials databases

    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENSRNOT00000066384; ENSRNOP00000063446; ENSRNOG00000042536 [P14270-9]
    ENSRNOT00000067546; ENSRNOP00000062384; ENSRNOG00000042536 [P14270-7]
    GeneIDi24627
    KEGGirno:24627

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    5144
    RGDi3281 Pde4d

    Phylogenomic databases

    eggNOGiKOG3689 Eukaryota
    ENOG410XRI7 LUCA
    GeneTreeiENSGT00940000155674
    InParanoidiP14270
    KOiK13293
    OrthoDBi904682at2759
    PhylomeDBiP14270

    Enzyme and pathway databases

    UniPathwayiUPA00762;UER00747
    BRENDAi3.1.4.53 5301
    ReactomeiR-RNO-180024 DARPP-32 events
    R-RNO-418555 G alpha (s) signalling events

    Miscellaneous databases

    Protein Ontology

    More...
    PROi
    PR:P14270

    Gene expression databases

    BgeeiENSRNOG00000042536 Expressed in 9 organ(s), highest expression level in skeletal muscle tissue
    ExpressionAtlasiP14270 baseline and differential
    GenevisibleiP14270 RN

    Family and domain databases

    CDDicd00077 HDc, 1 hit
    Gene3Di1.10.1300.10, 1 hit
    InterProiView protein in InterPro
    IPR003607 HD/PDEase_dom
    IPR040844 PDE4_UCR
    IPR023088 PDEase
    IPR002073 PDEase_catalytic_dom
    IPR036971 PDEase_catalytic_dom_sf
    IPR023174 PDEase_CS
    PfamiView protein in Pfam
    PF18100 PDE4_UCR, 1 hit
    PF00233 PDEase_I, 1 hit
    PRINTSiPR00387 PDIESTERASE1
    PROSITEiView protein in PROSITE
    PS00126 PDEASE_I_1, 1 hit
    PS51845 PDEASE_I_2, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPDE4D_RAT
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P14270
    Secondary accession number(s): A1E347
    , A1EC59, F1M1H7, O35470, Q6TRI0, Q8CG04, Q8CG06
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 1, 1990
    Last sequence update: January 4, 2005
    Last modified: May 8, 2019
    This is version 164 of the entry and version 4 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again