UniProtKB - P14135 (RL6_HALMA)

BLAST

>sp|P14135|RL6_HALMA 50S ribosomal protein L6 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) OX=272569 GN=rpl6 PE=1 SV=3
MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTM
STIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIH
GDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKPNRGDA

Align
Format
Add to basket Added to basket
History
Entry version 136 (10 Oct 2018)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

50S ribosomal protein L6

Gene

rpl6

Organism

Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

GO - Molecular functionⁱ

rRNA binding Source: UniProtKB-UniRule
structural constituent of ribosome Source: InterPro

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

translation Source: UniProtKB-UniRule

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Molecular function

Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: 50S ribosomal protein L6UniRule annotation Alternative name(s): Hl10 Hmal6
Gene namesⁱ	Name:rpl6UniRule annotation Ordered Locus Names:rrnAC1596
Organismⁱ	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)
Taxonomic identifierⁱ	272569 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Archaea › Euryarchaeota › Stenosarchaea group › Halobacteria › Halobacteriales › Haloarculaceae › Haloarcula › Haloarcula marismortui
Proteomesⁱ	UP000001169 Componentⁱ: Chromosome I

Subcellular locationⁱ

GO - Cellular componentⁱ

ribosome Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		Removed2 Publications
ChainⁱPRO_0000131083	2 – 178	50S ribosomal protein L6Add BLAST		177

Proteomic databases

PRIDEⁱ	P14135

PRIDEⁱ

P14135

Interactionⁱ

Subunit structureⁱ

Part of the 50S ribosomal subunit. Interacts weakly with protein L13.UniRule annotation2 Publications

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1596

STRINGⁱ

272569.rrnAC1596

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	3 – 7	Combined sources	5
Beta strandⁱ	13 – 17	Combined sources	5
Beta strandⁱ	20 – 25	Combined sources	6
Beta strandⁱ	28 – 33	Combined sources	6
Beta strandⁱ	40 – 44	Combined sources	5
Beta strandⁱ	47 – 51	Combined sources	5
Helixⁱ	57 – 77	Combined sources	21
Beta strandⁱ	81 – 88	Combined sources	8
Beta strandⁱ	90 – 92	Combined sources	3
Beta strandⁱ	95 – 99	Combined sources	5
Beta strandⁱ	102 – 107	Combined sources	6
Helixⁱ	108 – 110	Combined sources	3
Beta strandⁱ	115 – 118	Combined sources	4
Beta strandⁱ	124 – 128	Combined sources	5
Beta strandⁱ	131 – 137	Combined sources	7
Helixⁱ	139 – 151	Combined sources	13
Beta strandⁱ	156 – 158	Combined sources	3
Turnⁱ	160 – 162	Combined sources	3
Beta strandⁱ	166 – 171	Combined sources	6

Show more details

3D structure databases

ProteinModelPortalⁱ	P14135
SMRⁱ	P14135
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P14135

EvolutionaryTraceⁱ

P14135

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the universal ribosomal protein uL6 family.UniRule annotation

Phylogenomic databases

eggNOGⁱ	arCOG04090 Archaea COG0097 LUCA
HOGENOMⁱ	HOG000039905
KEGG Orthology (KO) More...KOⁱ	K02933
OMAⁱ	VFQDGIY
Database of Orthologous Groups More...OrthoDBⁱ	POG093Z0CBF

Family and domain databases

Gene3Dⁱ	3.90.930.12, 2 hits
HAMAPⁱ	MF_01365_A Ribosomal_L6_A, 1 hit
InterProⁱ	View protein in InterPro IPR000702 Ribosomal_L6 IPR020040 Ribosomal_L6_a/b-dom IPR036789 Ribosomal_L6_a/b-dom_sf IPR002359 Ribosomal_L6_CS2 IPR019907 Ribosomal_L6P_arc
PANTHERⁱ	PTHR11655 PTHR11655, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00347 Ribosomal_L6, 2 hits
PIRSFⁱ	PIRSF002162 Ribosomal_L6, 1 hit
SUPFAMⁱ	SSF56053 SSF56053, 2 hits
TIGRFAMsⁱ	TIGR03653 uL6_arch, 1 hit
PROSITEⁱ	View protein in PROSITE PS00700 RIBOSOMAL_L6_2, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P14135-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MPRVELEIPE DVDAEQDHLD ITVEGDNGSV TRRLWYPDID VSVDGDTVVI 
        60         70         80         90        100
ESDEDNAKTM STIGTFQSHI ENMFHGVTEG WEYGMEVFYS HFPMQVNVEG 
       110        120        130        140        150
DEVVIENFLG EKAPRRTTIH GDTDVEIDGE ELTVSGPDIE AVGQTAADIE 
       160        170 
QLTRINDKDV RVFQDGVYIT RKPNRGDA

Length:178

Mass (Da):19,944

Last modified:January 23, 2007 - v3

Checksum:ⁱ380872452165689C

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱ	3	R → S.		1
Natural variantⁱ	24	E → S.		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X58395 Genomic DNA Translation: CAA41287.1 AY596297 Genomic DNA Translation: AAV46514.1
PIRⁱ	S16538 R5HS6L
NCBI Reference Sequences More...RefSeqⁱ	WP_011223740.1, NC_006396.1

Genome annotation databases

EnsemblBacteriaⁱ	AAV46514; AAV46514; rrnAC1596
GeneIDⁱ	3127517
KEGGⁱ	hma:rrnAC1596
PATRICⁱ	fig\|272569.17.peg.2285

Protein	Similar proteins		Species	Score	Length	Source
P14135	50S ribosomal protein L6		HALHT		178	UniRef90_P14135
50S ribosomal protein L6		Haloarcula amylolytica JCM 13557		178
50S ribosomal protein L6		Haloarcula hispanica N601		178
50S ribosomal protein L6		Haloarcula sp. K1		178
50S ribosomal protein L6		Haloarcula rubripromontorii		178
+10

Protein	Similar proteins		Species	Score	Length	Source
P14135	50S ribosomal protein L6		HALWD		182	UniRef50_P14135
50S ribosomal protein L6		NATPD		177
50S ribosomal protein L6		HALSA		178
50S ribosomal protein L6		Haloarcula sinaiiensis ATCC 33800		178
50S ribosomal protein L6		Haloarcula californiae ATCC 33799		178
+263

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X58395 Genomic DNA Translation: CAA41287.1 AY596297 Genomic DNA Translation: AAV46514.1
PIRⁱ	S16538 R5HS6L
RefSeqⁱ	WP_011223740.1, NC_006396.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1C04	X-ray	5.00	B	21-25	[»]
	1FFK	X-ray	2.40	1	2-178	[»]
	1JJ2	X-ray	2.40	E	2-178	[»]
	1K73	X-ray	3.01	G	2-178	[»]
	1K8A	X-ray	3.00	G	2-178	[»]
	1K9M	X-ray	3.00	G	2-178	[»]
	1KC8	X-ray	3.01	G	2-178	[»]
	1KD1	X-ray	3.00	G	2-178	[»]
	1KQS	X-ray	3.10	E	2-178	[»]
	1M1K	X-ray	3.20	G	2-178	[»]
	1M90	X-ray	2.80	G	2-178	[»]
	1N8R	X-ray	3.00	G	2-178	[»]
	1NJI	X-ray	3.00	G	2-178	[»]
	1Q7Y	X-ray	3.20	G	2-178	[»]
	1Q81	X-ray	2.95	G	2-178	[»]
	1Q82	X-ray	2.98	G	2-178	[»]
	1Q86	X-ray	3.00	G	2-178	[»]
	1QVF	X-ray	3.10	E	2-178	[»]
	1QVG	X-ray	2.90	E	2-178	[»]
	1S72	X-ray	2.40	E	1-178	[»]
	1VQ4	X-ray	2.70	E	1-178	[»]
	1VQ5	X-ray	2.60	E	1-178	[»]
	1VQ6	X-ray	2.70	E	1-178	[»]
	1VQ7	X-ray	2.50	E	1-178	[»]
	1VQ8	X-ray	2.20	E	1-178	[»]
	1VQ9	X-ray	2.40	E	1-178	[»]
	1VQK	X-ray	2.30	E	1-178	[»]
	1VQL	X-ray	2.30	E	1-178	[»]
	1VQM	X-ray	2.30	E	1-178	[»]
	1VQN	X-ray	2.40	E	1-178	[»]
	1VQO	X-ray	2.20	E	1-178	[»]
	1VQP	X-ray	2.25	E	1-178	[»]
	1W2B	X-ray	3.50	E	2-178	[»]
	1YHQ	X-ray	2.40	E	1-178	[»]
	1YI2	X-ray	2.65	E	1-178	[»]
	1YIJ	X-ray	2.60	E	1-178	[»]
	1YIT	X-ray	2.80	E	1-178	[»]
	1YJ9	X-ray	2.90	E	1-178	[»]
	1YJN	X-ray	3.00	E	1-178	[»]
	1YJW	X-ray	2.90	E	1-178	[»]
	2OTJ	X-ray	2.90	E	1-178	[»]
	2OTL	X-ray	2.70	E	1-178	[»]
	2QA4	X-ray	3.00	E	1-178	[»]
	2QEX	X-ray	2.90	E	1-178	[»]
	3CC2	X-ray	2.40	E	1-178	[»]
	3CC4	X-ray	2.70	E	1-178	[»]
	3CC7	X-ray	2.70	E	1-178	[»]
	3CCE	X-ray	2.75	E	1-178	[»]
	3CCJ	X-ray	2.70	E	1-178	[»]
	3CCL	X-ray	2.90	E	1-178	[»]
	3CCM	X-ray	2.55	E	1-178	[»]
	3CCQ	X-ray	2.90	E	1-178	[»]
	3CCR	X-ray	3.00	E	1-178	[»]
	3CCS	X-ray	2.95	E	1-178	[»]
	3CCU	X-ray	2.80	E	1-178	[»]
	3CCV	X-ray	2.90	E	1-178	[»]
	3CD6	X-ray	2.75	E	1-178	[»]
	3CMA	X-ray	2.80	E	1-178	[»]
	3CME	X-ray	2.95	E	1-178	[»]
	3CPW	X-ray	2.70	E	1-178	[»]
	3CXC	X-ray	3.00	E	2-178	[»]
	3G4S	X-ray	3.20	E	2-173	[»]
	3G6E	X-ray	2.70	E	2-173	[»]
3G71	X-ray	2.85	E	2-173	[»]
3I55	X-ray	3.11	E	1-178	[»]
3I56	X-ray	2.90	E	1-178	[»]
3OW2	X-ray	2.70	E	2-173	[»]
4ADX	electron microscopy	6.60	E	1-178	[»]
4V9F	X-ray	2.40	E	1-178	[»]
ProteinModelPortalⁱ	P14135
SMRⁱ	P14135
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1596

STRINGⁱ

272569.rrnAC1596

Proteomic databases

PRIDEⁱ	P14135

PRIDEⁱ

P14135

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAV46514; AAV46514; rrnAC1596
GeneIDⁱ	3127517
KEGGⁱ	hma:rrnAC1596
PATRICⁱ	fig\|272569.17.peg.2285

Phylogenomic databases

eggNOGⁱ	arCOG04090 Archaea COG0097 LUCA
HOGENOMⁱ	HOG000039905
KOⁱ	K02933
OMAⁱ	VFQDGIY
OrthoDBⁱ	POG093Z0CBF

Miscellaneous databases

EvolutionaryTraceⁱ	P14135

EvolutionaryTraceⁱ

P14135

Family and domain databases

Gene3Dⁱ	3.90.930.12, 2 hits
HAMAPⁱ	MF_01365_A Ribosomal_L6_A, 1 hit
InterProⁱ	View protein in InterPro IPR000702 Ribosomal_L6 IPR020040 Ribosomal_L6_a/b-dom IPR036789 Ribosomal_L6_a/b-dom_sf IPR002359 Ribosomal_L6_CS2 IPR019907 Ribosomal_L6P_arc
PANTHERⁱ	PTHR11655 PTHR11655, 1 hit
Pfamⁱ	View protein in Pfam PF00347 Ribosomal_L6, 2 hits
PIRSFⁱ	PIRSF002162 Ribosomal_L6, 1 hit
SUPFAMⁱ	SSF56053 SSF56053, 2 hits
TIGRFAMsⁱ	TIGR03653 uL6_arch, 1 hit
PROSITEⁱ	View protein in PROSITE PS00700 RIBOSOMAL_L6_2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RL6_HALMA
Accessionⁱ	P14135Primary (citable) accession number: P14135 Secondary accession number(s): P12739, Q5V1T8
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	January 1, 1990
	Last sequence update:	January 23, 2007
	Last modified:	October 10, 2018
	This is version 136 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P14135 (RL6_HALMA)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

50S ribosomal protein L6

rpl6

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Natural variant

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ