UniProtKB - P14119 (RL19E_HALMA)

BLAST

>sp|P14119|RL19E_HALMA 50S ribosomal protein L19e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) OX=272569 GN=rpl19e PE=1 SV=3
MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSR
GRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQY
RDLYDKAGGGEFDSVADLERYIDANHGDA

Align
Format
Add to basket Added to basket
History
Entry version 132 (07 Nov 2018)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

50S ribosomal protein L19e

Gene

rpl19e

Organism

Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Binds to the 23S rRNA. Located at the polypeptide exit tunnel on the outside of the subunit.

GO - Molecular functionⁱ

large ribosomal subunit rRNA binding Source: UniProtKB-UniRule
structural constituent of ribosome Source: InterPro

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

translation Source: UniProtKB-UniRule

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Molecular function

Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: 50S ribosomal protein L19eUniRule annotation Alternative name(s): Hl24 Hmal19
Gene namesⁱ	Name:rpl19eUniRule annotation Ordered Locus Names:rrnAC1594
Organismⁱ	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)
Taxonomic identifierⁱ	272569 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Archaea › Euryarchaeota › Stenosarchaea group › Halobacteria › Halobacteriales › Haloarculaceae › Haloarcula › Haloarcula marismortui
Proteomesⁱ	UP000001169 Componentⁱ: Chromosome I

Subcellular locationⁱ

GO - Cellular componentⁱ

ribosome Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		Removed1 Publication
ChainⁱPRO_0000131187	2 – 149	50S ribosomal protein L19eAdd BLAST		148

Proteomic databases

PRIDEⁱ	P14119

PRIDEⁱ

P14119

Interactionⁱ

Subunit structureⁱ

Part of the 50S ribosomal subunit.UniRule annotation3 Publications

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1594

STRINGⁱ

272569.rrnAC1594

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	5 – 14	Combined sources	10
Helixⁱ	19 – 21	Combined sources	3
Beta strandⁱ	22 – 24	Combined sources	3
Helixⁱ	26 – 28	Combined sources	3
Helixⁱ	29 – 34	Combined sources	6
Helixⁱ	38 – 46	Combined sources	9
Beta strandⁱ	49 – 52	Combined sources	4
Helixⁱ	61 – 71	Combined sources	11
Helixⁱ	78 – 80	Combined sources	3
Helixⁱ	85 – 88	Combined sources	4
Helixⁱ	91 – 111	Combined sources	21
Beta strandⁱ	112 – 115	Combined sources	4
Helixⁱ	117 – 127	Combined sources	11
Turnⁱ	128 – 130	Combined sources	3
Helixⁱ	135 – 142	Combined sources	8

Show more details

3D structure databases

ProteinModelPortalⁱ	P14119
SMRⁱ	P14119
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P14119

EvolutionaryTraceⁱ

P14119

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the eukaryotic ribosomal protein eL19 family.UniRule annotation

Phylogenomic databases

eggNOGⁱ	arCOG04089 Archaea COG2147 LUCA
HOGENOMⁱ	HOG000231276
KEGG Orthology (KO) More...KOⁱ	K02885
OMAⁱ	NRVWIDP
Database of Orthologous Groups More...OrthoDBⁱ	POG093Z0FV0

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd01418 Ribosomal_L19e_A, 1 hit
Gene3Dⁱ	1.10.1200.60, 1 hit 1.10.1650.10, 1 hit 1.20.5.560, 1 hit
HAMAPⁱ	MF_01475 Ribosomal_L19e, 1 hit
InterProⁱ	View protein in InterPro IPR035970 60S_ribosomal_L19/L19e_sf IPR000196 Ribosomal_L19/L19e IPR023638 Ribosomal_L19/L19e_CS IPR015972 Ribosomal_L19/L19e_dom1 IPR015973 Ribosomal_L19/L19e_dom2 IPR015974 Ribosomal_L19/L19e_dom3 IPR033936 Ribosomal_L19e_A IPR039547 RPL19
PANTHERⁱ	PTHR10722 PTHR10722, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF01280 Ribosomal_L19e, 1 hit
SMARTⁱ	View protein in SMART SM01416 Ribosomal_L19e, 1 hit
SUPFAMⁱ	SSF48140 SSF48140, 1 hit
PROSITEⁱ	View protein in PROSITE PS00526 RIBOSOMAL_L19E, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P14119-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MTDLSAQKRL AADVLDVGKN RVWFNPERQG DIADAITRED VRELVDEGAI 
        60         70         80         90        100
QAKDKKGNSR GRARERQKKR AYGHQKGAGS RKGKAGARQN SKEDWESRIR 
       110        120        130        140 
AQRTKLRELR DEGTLSSSQY RDLYDKAGGG EFDSVADLER YIDANHGDA

Length:149

Mass (Da):16,762

Last modified:January 23, 2007 - v3

Checksum:ⁱ210F99E836B0B817

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	82	K → G AA sequence (PubMed:2591382).Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X58395 Genomic DNA Translation: CAA41289.1 AY596297 Genomic DNA Translation: AAV46512.1
PIRⁱ	S16540 R5HSH4
NCBI Reference Sequences More...RefSeqⁱ	WP_004516953.1, NC_006396.1

Genome annotation databases

EnsemblBacteriaⁱ	AAV46512; AAV46512; rrnAC1594
GeneIDⁱ	3127911
KEGGⁱ	hma:rrnAC1594
PATRICⁱ	fig\|272569.17.peg.2283

Protein	Similar proteins		Species	Score	Length	Source
P14119	50S ribosomal protein L19e		Haloarcula vallismortis ATCC 29715		149	UniRef100_P14119
50S ribosomal protein L19e		HALVA		149
50S ribosomal protein L19e		Haloarcula sinaiiensis ATCC 33800		149
50S ribosomal protein L19e		Haloarcula argentinensis DSM 12282		149
50S ribosomal protein L19e		Haloarcula japonica DSM 6131		149
+2

Protein	Similar proteins		Species	Score	Length	Source
P14119	50S ribosomal protein L19e		Haloarcula vallismortis ATCC 29715		149	UniRef90_P14119
50S ribosomal protein L19e		HALVA		149
50S ribosomal protein L19e		Haloarcula sinaiiensis ATCC 33800		149
50S ribosomal protein L19e		Haloarcula argentinensis DSM 12282		149
50S ribosomal protein L19e		Haloarcula japonica DSM 6131		149
+11

Protein	Similar proteins		Species	Score	Length	Source
P14119	50S ribosomal protein L19e		HALSA		149	UniRef50_P14119
50S ribosomal protein L19e		NATPD		149
50S ribosomal protein L19e		Haloarcula vallismortis ATCC 29715		149
50S ribosomal protein L19e		HALVA		149
50S ribosomal protein L19e		Haloarcula sinaiiensis ATCC 33800		149
+430

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X58395 Genomic DNA Translation: CAA41289.1 AY596297 Genomic DNA Translation: AAV46512.1
PIRⁱ	S16540 R5HSH4
RefSeqⁱ	WP_004516953.1, NC_006396.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1FFK	X-ray	2.40	M	2-149	[»]
	1JJ2	X-ray	2.40	O	2-149	[»]
	1K73	X-ray	3.01	Q	2-149	[»]
	1K8A	X-ray	3.00	Q	2-149	[»]
	1K9M	X-ray	3.00	Q	2-149	[»]
	1KC8	X-ray	3.01	Q	2-149	[»]
	1KD1	X-ray	3.00	Q	2-149	[»]
	1KQS	X-ray	3.10	O	2-149	[»]
	1M1K	X-ray	3.20	Q	2-149	[»]
	1M90	X-ray	2.80	Q	2-149	[»]
	1N8R	X-ray	3.00	Q	2-149	[»]
	1NJI	X-ray	3.00	Q	2-149	[»]
	1Q7Y	X-ray	3.20	Q	2-149	[»]
	1Q81	X-ray	2.95	Q	2-149	[»]
	1Q82	X-ray	2.98	Q	2-149	[»]
	1Q86	X-ray	3.00	Q	2-149	[»]
	1QVF	X-ray	3.10	O	2-149	[»]
	1QVG	X-ray	2.90	O	2-149	[»]
	1S72	X-ray	2.40	P	1-149	[»]
	1VQ4	X-ray	2.70	P	1-149	[»]
	1VQ5	X-ray	2.60	P	1-149	[»]
	1VQ6	X-ray	2.70	P	1-149	[»]
	1VQ7	X-ray	2.50	P	1-149	[»]
	1VQ8	X-ray	2.20	P	1-149	[»]
	1VQ9	X-ray	2.40	P	1-149	[»]
	1VQK	X-ray	2.30	P	1-149	[»]
	1VQL	X-ray	2.30	P	1-149	[»]
	1VQM	X-ray	2.30	P	1-149	[»]
	1VQN	X-ray	2.40	P	1-149	[»]
	1VQO	X-ray	2.20	P	1-149	[»]
	1VQP	X-ray	2.25	P	1-149	[»]
	1W2B	X-ray	3.50	O	2-149	[»]
	1YHQ	X-ray	2.40	P	1-149	[»]
	1YI2	X-ray	2.65	P	1-149	[»]
	1YIJ	X-ray	2.60	P	1-149	[»]
	1YIT	X-ray	2.80	P	1-149	[»]
	1YJ9	X-ray	2.90	P	1-149	[»]
	1YJN	X-ray	3.00	P	1-149	[»]
	1YJW	X-ray	2.90	P	1-149	[»]
	2OTJ	X-ray	2.90	P	1-149	[»]
	2OTL	X-ray	2.70	P	1-149	[»]
	2QA4	X-ray	3.00	P	1-149	[»]
	2QEX	X-ray	2.90	P	1-149	[»]
	3CC2	X-ray	2.40	P	1-149	[»]
	3CC4	X-ray	2.70	P	1-149	[»]
	3CC7	X-ray	2.70	P	1-149	[»]
	3CCE	X-ray	2.75	P	1-149	[»]
	3CCJ	X-ray	2.70	P	1-149	[»]
	3CCL	X-ray	2.90	P	1-149	[»]
	3CCM	X-ray	2.55	P	1-149	[»]
	3CCQ	X-ray	2.90	P	1-149	[»]
	3CCR	X-ray	3.00	P	1-149	[»]
	3CCS	X-ray	2.95	P	1-149	[»]
	3CCU	X-ray	2.80	P	1-149	[»]
	3CCV	X-ray	2.90	P	1-149	[»]
	3CD6	X-ray	2.75	P	1-149	[»]
	3CMA	X-ray	2.80	P	1-149	[»]
	3CME	X-ray	2.95	P	1-149	[»]
	3CPW	X-ray	2.70	O	1-149	[»]
	3CXC	X-ray	3.00	O	2-149	[»]
	3G4S	X-ray	3.20	P	2-144	[»]
	3G6E	X-ray	2.70	P	2-144	[»]
	3G71	X-ray	2.85	P	2-144	[»]
3I55	X-ray	3.11	P	1-149	[»]
3I56	X-ray	2.90	P	1-149	[»]
3OW2	X-ray	2.70	O	2-144	[»]
4ADX	electron microscopy	6.60	P	1-149	[»]
4V9F	X-ray	2.40	P	1-149	[»]
ProteinModelPortalⁱ	P14119
SMRⁱ	P14119
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1594

STRINGⁱ

272569.rrnAC1594

Proteomic databases

PRIDEⁱ	P14119

PRIDEⁱ

P14119

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAV46512; AAV46512; rrnAC1594
GeneIDⁱ	3127911
KEGGⁱ	hma:rrnAC1594
PATRICⁱ	fig\|272569.17.peg.2283

Phylogenomic databases

eggNOGⁱ	arCOG04089 Archaea COG2147 LUCA
HOGENOMⁱ	HOG000231276
KOⁱ	K02885
OMAⁱ	NRVWIDP
OrthoDBⁱ	POG093Z0FV0

Miscellaneous databases

EvolutionaryTraceⁱ	P14119

EvolutionaryTraceⁱ

P14119

Family and domain databases

CDDⁱ	cd01418 Ribosomal_L19e_A, 1 hit
Gene3Dⁱ	1.10.1200.60, 1 hit 1.10.1650.10, 1 hit 1.20.5.560, 1 hit
HAMAPⁱ	MF_01475 Ribosomal_L19e, 1 hit
InterProⁱ	View protein in InterPro IPR035970 60S_ribosomal_L19/L19e_sf IPR000196 Ribosomal_L19/L19e IPR023638 Ribosomal_L19/L19e_CS IPR015972 Ribosomal_L19/L19e_dom1 IPR015973 Ribosomal_L19/L19e_dom2 IPR015974 Ribosomal_L19/L19e_dom3 IPR033936 Ribosomal_L19e_A IPR039547 RPL19
PANTHERⁱ	PTHR10722 PTHR10722, 1 hit
Pfamⁱ	View protein in Pfam PF01280 Ribosomal_L19e, 1 hit
SMARTⁱ	View protein in SMART SM01416 Ribosomal_L19e, 1 hit
SUPFAMⁱ	SSF48140 SSF48140, 1 hit
PROSITEⁱ	View protein in PROSITE PS00526 RIBOSOMAL_L19E, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RL19E_HALMA
Accessionⁱ	P14119Primary (citable) accession number: P14119 Secondary accession number(s): Q5V1U0
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	January 1, 1990
	Last sequence update:	January 23, 2007
	Last modified:	November 7, 2018
	This is version 132 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P14119 (RL19E_HALMA)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

50S ribosomal protein L19e

rpl19e

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ