Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P13607 (ATNA_DROME)

Protein

Sodium/potassium-transporting ATPase subunit alpha

Gene

Atpalpha

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients.3 Publications

Miscellaneous

Ouabain-sensitive electrogenic ion pump.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei3944-aspartylphosphate intermediateCurated1
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei526ATPBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • sodium:potassium-exchanging ATPase activity Source: FlyBase
View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
Biological processIon transport, Potassium transport, Sodium transport, Sodium/potassium transport, Transport
LigandATP-binding, Nucleotide-binding, Potassium, Sodium

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sodium/potassium-transporting ATPase subunit alpha (EC:3.6.3.9)
Short name:
Na(+)/K(+) ATPase alpha subunit
Alternative name(s):
Sodium pump subunit alpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Atpalpha
Synonyms:Na-p
ORF Names:CG5670
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Holometabola › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora ›
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3R

Organism-specific databases

Drosophila genome database

More...FlyBasei		FBgn0002921 Atpalpha

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei115 – 135HelicalSequence analysisAdd BLAST21
Transmembranei147 – 167HelicalSequence analysisAdd BLAST21
Transmembranei312 – 332HelicalSequence analysisAdd BLAST21
Transmembranei338 – 358HelicalSequence analysisAdd BLAST21
Transmembranei808 – 828HelicalSequence analysisAdd BLAST21
Transmembranei870 – 890HelicalSequence analysisAdd BLAST21
Transmembranei935 – 955HelicalSequence analysisAdd BLAST21
Transmembranei970 – 990HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1020D → N in allele ATP-alpha-dts2; homozygous lethal and temperature dependent bang sensitive paralysis, shortened life span and neurodegeneration when heterozygous. 1 Publication1
Mutagenesisi1021E → K in allele ATP-alpha-dts1; homozygous lethal and temperature dependent bang sensitive paralysis, shortened life span and neurodegeneration when heterozygous. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000463091 – 1041Sodium/potassium-transporting ATPase subunit alphaAdd BLAST1041

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P13607

PRoteomics IDEntifications database

More...PRIDEi		P13607

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

High levels are found in some adult tissues: Malpighian tubules, indirect flight muscles, tubular leg muscles and throughout the nervous system (brain, optic lobes, retina and ventral thoracic neuromere). Lower levels are detected at the posterior end where the reproductive organs and rectum are located.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		FBgn0002921 Expressed in 31 organ(s), highest expression level in adult Malpighian tubule (Drosophila)

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P13607 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P13607 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The sodium/potassium-transporting ATPase is composed of a catalytic alpha subunit, an auxiliary non-catalytic beta subunit and an additional regulatory subunit.Curated

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		71866, 58 interactors

Database of interacting proteins

More...DIPi		DIP-19649N

Protein interaction database and analysis system

More...IntActi		P13607, 36 interactors

STRING: functional protein association networks

More...STRINGi		7227.FBpp0088502

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		P13607

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P13607

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIC subfamily. [View classification]Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0203 Eukaryota
COG0474 LUCA

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P13607

KEGG Orthology (KO)

More...KOi		K01539

Identification of Orthologs from Complete Genome Data

More...OMAi		HMLRTRK

Database of Orthologous Groups

More...OrthoDBi		EOG091G01BB

Database for complete collections of gene phylogenies

More...PhylomeDBi		P13607

Family and domain databases

Conserved Domains Database

More...CDDi		cd02608 P-type_ATPase_Na-K_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.1110.10, 1 hit
3.40.50.1000, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR006068 ATPase_P-typ_cation-transptr_C
IPR004014 ATPase_P-typ_cation-transptr_N
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR005775 P-type_ATPase_IIC
IPR001757 P_typ_ATPase

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00689 Cation_ATPase_C, 1 hit
PF00690 Cation_ATPase_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00831 Cation_ATPase_N, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF56784 SSF56784, 1 hit
SSF81653 SSF81653, 1 hit
SSF81660 SSF81660, 1 hit
SSF81665 SSF81665, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR01106 ATPase-IIC_X-K, 1 hit
TIGR01494 ATPase_P-type, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Exon 6 has 4 mutually exclusive forms (6a, 6b, 6c and 6d). Additional isoforms may exist.

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P13607-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALRSDYEHG RADSYRVATV IATDDDNRTA DGQYKSRRKM PAKVNKKENL 
        60         70         80         90        100
DDLKQELDID FHKISPEELY QRFQTHPENG LSHAKAKENL ERDGPNALTP 
       110        120        130        140        150
PKQTPEWVKF CKNLFGGFAM LLWIGAILCF VAYSIQASTS EEPADDNLYL 
       160        170        180        190        200
GIVLSAVVIV TGIFSYYQES KSSKIMESFK NMVPQFATVI REGEKLTLRA 
       210        220        230        240        250
EDLVLGDVVE VKFGDRIPAD IRIIEARNFK VDNSSLTGES EPQSRGAEFT 
       260        270        280        290        300
HENPLETKNL AFFSTNAVEG TAKGVVISCG DHTVMGRIAG LASGLDTGET 
       310        320        330        340        350
PIAKEIHHFI HLITGVAVFL GVTFFVIAFI LGYHWLDAVI FLIGIIVANV 
       360        370        380        390        400
PEGLLATVTV CLTLTAKRMA SKNCLVKNLE AVETLGSTST ICSDKTGTLT 
       410        420        430        440        450
QNRMTVAHMW FDNQIIEADT TEDQSGVQYD RTSPGFKALS RIATLCNRAE 
       460        470        480        490        500
FKGGQDGVPI LKKEVSGDAS EAALLKCMEL ALGDVMNIRK RNKKIAEVPF 
       510        520        530        540        550
NSTNKYQVSI HETEDTNDPR YLLVMKGAPE RILERCSTIF INGKEKVLDE 
       560        570        580        590        600
EMKEAFNNAY MELGGLGERV LGFCDFMLPS DKYPNGFKFN TDDINFPIDN 
       610        620        630        640        650
LRFVGLMSMI DPPRAAVPDA VAKCRSAGIK VIMVTGDHPI TAKAIAKSVG 
       660        670        680        690        700
IISEGNETVE DIAQRLNIPV SEVNPREAKA AVVHGAELRD VSSDQLDEIL 
       710        720        730        740        750
RYHTEIVFAR TSPQQKLIIV EGCQRMGAIV AVTGDGVNDS PALKKADIGV 
       760        770        780        790        800
AMGIAGSDVS KQAADMILLD DNFASIVTGV EEGRLIFDNL KKSIAYTLTS 
       810        820        830        840        850
NIPEISPFLA FILCDIPLPL GTVTILCIDL GTDMVPAISL AYEHAEADIM 
       860        870        880        890        900
KRPPRDPFND KLVNSRLISM AYGQIGMIQA AAGFFVYFVI MAENGFLPKK 
       910        920        930        940        950
LFGIRKMWDS KAVNDLTDSY GQEWTYRDRK TLEYTCHTAF FISIVVVQWA 
       960        970        980        990       1000
DLIICKTRRN SIFQQGMRNW ALNFGLVFET VLAAFLSYCP GMEKGLRMYP 
      1010       1020       1030       1040 
LKLVWWFPAI PFALAIFIYD ETRRFYLRRN PGGWLEQETY Y
Length:1,041
Mass (Da):115,605
Last modified:June 20, 2001 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB2DD36B2E9029F43
GO
Isoform 2 (identifier: P13607-2) [UniParc]FASTAAdd to basket
Also known as: B, C, E

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.

Show »
Length:1,002
Mass (Da):111,133
Checksum:iCA77B36B10EB23E2
GO
Isoform 3 (identifier: P13607-3) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.
     836-878: PAISLAYEHA...SMAYGQIGMI → SLDLCPKPKL...CSPSQLIVKN
     879-1041: Missing.

Note: No experimental confirmation available.
Show »
Length:839
Mass (Da):91,981
Checksum:iD8D38F5B5BE2CD37
GO
Isoform 4 (identifier: P13607-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-8: MALRSDYE → MSAQ

Show »
Length:1,037
Mass (Da):115,056
Checksum:i62722EDBA74BBC88
GO
Isoform 5 (identifier: P13607-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     835-865: VPAISLAYEHAEADIMKRPPRDPFNDKLVNS → IPAISLAYEGPEADIMKRRPRNPEIDNLVNE

Show »
Length:1,041
Mass (Da):115,632
Checksum:iD6084967A87F4FAD
GO
Isoform 6 (identifier: P13607-6) [UniParc]FASTAAdd to basket
Also known as: F, H

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.
     844-865: HAEADIMKRPPRDPFNDKLVNS → TAESDIMKRQPRNPFQDKLVNE

Show »
Length:1,002
Mass (Da):111,199
Checksum:i4146F52C60C4114A
GO
Isoform 7 (identifier: P13607-7) [UniParc]FASTAAdd to basket
Also known as: G

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.
     835-865: VPAISLAYEHAEADIMKRPPRDPFNDKLVNS → IPAISLAYEQAESDIMKRQPRDPYRDNLVNR

Show »
Length:1,002
Mass (Da):111,298
Checksum:i9762610EA4A85D45
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E1JIR4E1JIR4_DROME
Sodium/potassium-transporting ATPas...
Atpalpha (Na[+], Atp a, ATP-alpha, ATPa, Atpa
1,002Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KGG8A0A0B4KGG8_DROME
Sodium/potassium-transporting ATPas...
Atpalpha (Na[+], Atp a, ATP-alpha, ATPa, Atpa
1,002Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti69L → M in CAA32638 (PubMed:2540956).Curated1
Sequence conflicti85K → R in CAA32638 (PubMed:2540956).Curated1
Sequence conflicti97Missing in CAA32638 (PubMed:2540956).Curated1
Sequence conflicti112 – 113KN → ED in CAA32638 (PubMed:2540956).Curated2
Sequence conflicti117 – 118GF → V in CAA32638 (PubMed:2540956).Curated2
Sequence conflicti163I → V in CAA32638 (PubMed:2540956).Curated1
Sequence conflicti192E → G in AAC05260 (PubMed:9648860).Curated1
Sequence conflicti196 – 197LT → PS in CAA32638 (PubMed:2540956).Curated2
Sequence conflicti207 – 208DV → VL in CAA32638 (PubMed:2540956).Curated2
Sequence conflicti211 – 212VK → LE in CAA32638 (PubMed:2540956).Curated2
Sequence conflicti216 – 221RIPADI → LIPLVY in CAA32638 (PubMed:2540956).Curated6
Sequence conflicti228N → D in CAA32638 (PubMed:2540956).Curated1
Sequence conflicti270 – 272GTA → ALP in CAA32638 (PubMed:2540956).Curated3
Sequence conflicti290G → A in CAA32638 (PubMed:2540956).Curated1
Sequence conflicti299Missing in CAA32638 (PubMed:2540956).Curated1
Sequence conflicti402N → T in CAA35504 (PubMed:2557235).Curated1
Sequence conflicti488I → N in CAA35504 (PubMed:2557235).Curated1
Sequence conflicti811F → S in CAA32638 (PubMed:2540956).Curated1
Sequence conflicti843E → D in CAA32638 (PubMed:2540956).Curated1

<p>This subsection of the ‘Sequence’ section provides information relevant to all types of RNA editing events (conversion, insertion, deletion of nucleotides) that lead to one or more amino acid changes compared to the translation of the non-edited RNA version.<p><a href='/help/rna_editing' target='_top'>More...</a></p>RNA editingi

Edited at position 429.2 Publications
Partially edited. Target of Adar.

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti429Y → C in RNA edited version. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0004171 – 39Missing in isoform 2, isoform 3, isoform 6 and isoform 7. 2 PublicationsAdd BLAST39
Alternative sequenceiVSP_0080741 – 8MALRSDYE → MSAQ in isoform 4. Curated8
Alternative sequenceiVSP_008075835 – 865VPAIS…KLVNS → IPAISLAYEGPEADIMKRRP RNPEIDNLVNE in isoform 5. CuratedAdd BLAST31
Alternative sequenceiVSP_008076835 – 865VPAIS…KLVNS → IPAISLAYEQAESDIMKRQP RDPYRDNLVNR in isoform 7. CuratedAdd BLAST31
Alternative sequenceiVSP_008077836 – 878PAISL…QIGMI → SLDLCPKPKLHRRLKLKLLL SQYHSSKLYSYTSCSPSQLI VKN in isoform 3. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_000418844 – 865HAEAD…KLVNS → TAESDIMKRQPRNPFQDKLV NE in isoform 6. CuratedAdd BLAST22
Alternative sequenceiVSP_008078879 – 1041Missing in isoform 3. 1 PublicationAdd BLAST163

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X14476 mRNA Translation: CAA32638.1
AF044974 mRNA Translation: AAC05260.1
AE014297 Genomic DNA Translation: AAF55825.3
AE014297 Genomic DNA Translation: AAF55826.2
AE014297 Genomic DNA Translation: AAF55828.1
AE014297 Genomic DNA Translation: AAS65183.1
AE014297 Genomic DNA Translation: AAS65184.1
AE014297 Genomic DNA Translation: AAS65185.1
AE014297 Genomic DNA Translation: AAS65186.1
AY069184 mRNA Translation: AAL39329.1
AY174097 Genomic DNA Translation: AAO33930.1
AY174097 Genomic DNA Translation: AAO33931.1
AY174097 Genomic DNA Translation: AAO33932.1
AY174097 Genomic DNA Translation: AAO33933.1
AY174098 Genomic DNA Translation: AAO33929.1
U55767 Genomic DNA Translation: AAB01189.1
X17471 mRNA Translation: CAA35504.1

Protein sequence database of the Protein Information Resource

More...PIRi		S03632

NCBI Reference Sequences

More...RefSeqi		NP_001262790.1, NM_001275861.1 [P13607-2]
NP_001262791.1, NM_001275862.2 [P13607-2]
NP_732572.1, NM_169936.3 [P13607-1]
NP_732573.1, NM_169937.3 [P13607-2]
NP_732574.1, NM_169938.3 [P13607-2]
NP_732575.1, NM_169939.2 [P13607-3]
NP_996247.1, NM_206525.3 [P13607-6]
NP_996248.1, NM_206526.3 [P13607-7]
NP_996249.1, NM_206527.3 [P13607-6]
NP_996250.1, NM_206528.3 [P13607-2]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Dm.6725

Genome annotation databases

Ensembl metazoan genome annotation project

More...EnsemblMetazoai		FBtr0089509; FBpp0088501; FBgn0002921 [P13607-2]
FBtr0089510; FBpp0088502; FBgn0002921 [P13607-1]
FBtr0089511; FBpp0088503; FBgn0002921 [P13607-2]
FBtr0089512; FBpp0088504; FBgn0002921 [P13607-3]
FBtr0089513; FBpp0088984; FBgn0002921 [P13607-2]
FBtr0089514; FBpp0088983; FBgn0002921 [P13607-6]
FBtr0089515; FBpp0088982; FBgn0002921 [P13607-7]
FBtr0089516; FBpp0088981; FBgn0002921 [P13607-6]
FBtr0333324; FBpp0305516; FBgn0002921 [P13607-2]
FBtr0333325; FBpp0305517; FBgn0002921 [P13607-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		48971

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		dme:Dmel_CG5670

UCSC genome browser

More...UCSCi		CG5670-RE d. melanogaster
CG5670-RH d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing, RNA editing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X14476 mRNA Translation: CAA32638.1
AF044974 mRNA Translation: AAC05260.1
AE014297 Genomic DNA Translation: AAF55825.3
AE014297 Genomic DNA Translation: AAF55826.2
AE014297 Genomic DNA Translation: AAF55828.1
AE014297 Genomic DNA Translation: AAS65183.1
AE014297 Genomic DNA Translation: AAS65184.1
AE014297 Genomic DNA Translation: AAS65185.1
AE014297 Genomic DNA Translation: AAS65186.1
AY069184 mRNA Translation: AAL39329.1
AY174097 Genomic DNA Translation: AAO33930.1
AY174097 Genomic DNA Translation: AAO33931.1
AY174097 Genomic DNA Translation: AAO33932.1
AY174097 Genomic DNA Translation: AAO33933.1
AY174098 Genomic DNA Translation: AAO33929.1
U55767 Genomic DNA Translation: AAB01189.1
X17471 mRNA Translation: CAA35504.1
PIRiS03632
RefSeqiNP_001262790.1, NM_001275861.1 [P13607-2]
NP_001262791.1, NM_001275862.2 [P13607-2]
NP_732572.1, NM_169936.3 [P13607-1]
NP_732573.1, NM_169937.3 [P13607-2]
NP_732574.1, NM_169938.3 [P13607-2]
NP_732575.1, NM_169939.2 [P13607-3]
NP_996247.1, NM_206525.3 [P13607-6]
NP_996248.1, NM_206526.3 [P13607-7]
NP_996249.1, NM_206527.3 [P13607-6]
NP_996250.1, NM_206528.3 [P13607-2]
UniGeneiDm.6725

3D structure databases

ProteinModelPortaliP13607
SMRiP13607
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi71866, 58 interactors
DIPiDIP-19649N
IntActiP13607, 36 interactors
STRINGi7227.FBpp0088502

Proteomic databases

PaxDbiP13607
PRIDEiP13607

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0089509; FBpp0088501; FBgn0002921 [P13607-2]
FBtr0089510; FBpp0088502; FBgn0002921 [P13607-1]
FBtr0089511; FBpp0088503; FBgn0002921 [P13607-2]
FBtr0089512; FBpp0088504; FBgn0002921 [P13607-3]
FBtr0089513; FBpp0088984; FBgn0002921 [P13607-2]
FBtr0089514; FBpp0088983; FBgn0002921 [P13607-6]
FBtr0089515; FBpp0088982; FBgn0002921 [P13607-7]
FBtr0089516; FBpp0088981; FBgn0002921 [P13607-6]
FBtr0333324; FBpp0305516; FBgn0002921 [P13607-2]
FBtr0333325; FBpp0305517; FBgn0002921 [P13607-2]
GeneIDi48971
KEGGidme:Dmel_CG5670
UCSCiCG5670-RE d. melanogaster
CG5670-RH d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		48971
FlyBaseiFBgn0002921 Atpalpha

Phylogenomic databases

eggNOGiKOG0203 Eukaryota
COG0474 LUCA
InParanoidiP13607
KOiK01539
OMAiHMLRTRK
OrthoDBiEOG091G01BB
PhylomeDBiP13607

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Atpalpha fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		48971

Protein Ontology

More...PROi		PR:P13607

Gene expression databases

BgeeiFBgn0002921 Expressed in 31 organ(s), highest expression level in adult Malpighian tubule (Drosophila)
ExpressionAtlasiP13607 baseline and differential
GenevisibleiP13607 DM

Family and domain databases

CDDicd02608 P-type_ATPase_Na-K_like, 1 hit
Gene3Di3.40.1110.10, 1 hit
3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR006068 ATPase_P-typ_cation-transptr_C
IPR004014 ATPase_P-typ_cation-transptr_N
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR005775 P-type_ATPase_IIC
IPR001757 P_typ_ATPase
PfamiView protein in Pfam
PF00689 Cation_ATPase_C, 1 hit
PF00690 Cation_ATPase_N, 1 hit
SMARTiView protein in SMART
SM00831 Cation_ATPase_N, 1 hit
SUPFAMiSSF56784 SSF56784, 1 hit
SSF81653 SSF81653, 1 hit
SSF81660 SSF81660, 1 hit
SSF81665 SSF81665, 1 hit
TIGRFAMsiTIGR01106 ATPase-IIC_X-K, 1 hit
TIGR01494 ATPase_P-type, 2 hits
PROSITEiView protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiATNA_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P13607
Secondary accession number(s): A4V366
, A4V367, O61494, Q0KI37, Q7KS94, Q7KS95, Q86MY6, Q86MY7, Q86MY8, Q86MY9, Q86MZ0, Q8IN40, Q8T0L8, Q9VDG6, Q9VDG7, Q9VDG8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: June 20, 2001
Last modified: December 5, 2018
This is version 196 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again