Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Intercellular adhesion molecule 1

Gene

Icam1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processCell adhesion

Enzyme and pathway databases

ReactomeiR-MMU-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-MMU-216083 Integrin cell surface interactions

Names & Taxonomyi

Protein namesi
Recommended name:
Intercellular adhesion molecule 1
Short name:
ICAM-1
Alternative name(s):
MALA-2
MyD10
CD_antigen: CD54
Gene namesi
Name:Icam1
Synonyms:Icam-1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:96392 Icam1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini28 – 485ExtracellularSequence analysisAdd BLAST458
Transmembranei486 – 509HelicalSequence analysisAdd BLAST24
Topological domaini510 – 537CytoplasmicSequence analysisAdd BLAST28

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Disruption phenotypei

Spontaneous onset of obesity in 16-week old mice with higher levels of white and brown fat and a slightly heavier liver. Enhanced susceptibility to high fat diet-induced obesity characterized by a weight increase and higher levels of white and brown fat.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 27By similarityAdd BLAST27
ChainiPRO_000001478528 – 537Intercellular adhesion molecule 1Add BLAST510

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi47N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi48 ↔ 91PROSITE-ProRule annotation
Disulfide bondi52 ↔ 95PROSITE-ProRule annotation
Disulfide bondi134 ↔ 188PROSITE-ProRule annotation
Glycosylationi185N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi204N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi239 ↔ 292PROSITE-ProRule annotation
Glycosylationi267N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi311N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi334 ↔ 374PROSITE-ProRule annotation
Glycosylationi362N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi388N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi406 ↔ 422By similarity
Glycosylationi409N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi422 ↔ 461PROSITE-ProRule annotation
Disulfide bondi434 ↔ 461By similarity
Glycosylationi456N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi469N-linked (GlcNAc...) asparagine1 Publication1

Post-translational modificationi

Monoubiquitinated, which is promoted by MARCH9 and leads to endocytosis.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei469Not glycosylated1 Publication1
Sitei485Not glycosylated1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein, Ubl conjugation

Proteomic databases

PaxDbiP13597
PeptideAtlasiP13597
PRIDEiP13597

PTM databases

iPTMnetiP13597
PhosphoSitePlusiP13597

Expressioni

Tissue specificityi

Expressed at low level on a subpopulation of lymphocytes, macrophages, and endothelial cells, but is strongly induced on these cells, and on fibroblasts and epithelial cells.

Gene expression databases

BgeeiENSMUSG00000037405 Expressed in 212 organ(s), highest expression level in lung
CleanExiMM_ICAM1
ExpressionAtlasiP13597 baseline and differential
GenevisibleiP13597 MM

Interactioni

Subunit structurei

Homodimer. Interacts with MUC1 and promotes cell aggregation in epithelial cells. Interacts with ARHGEF26/SGEF (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

DIPiDIP-29096N
IntActiP13597, 2 interactors
MINTiP13597
STRINGi10090.ENSMUSP00000083587

Structurei

3D structure databases

ProteinModelPortaliP13597
SMRiP13597
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini41 – 102Ig-like C2-type 1Add BLAST62
Domaini127 – 195Ig-like C2-type 2Add BLAST69
Domaini232 – 299Ig-like C2-type 3Add BLAST68
Domaini327 – 381Ig-like C2-type 4Add BLAST55
Domaini415 – 468Ig-like C2-type 5Add BLAST54

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi151 – 153Cell attachment site; atypicalSequence analysis3
Motifi179 – 181Cell attachment siteSequence analysis3

Sequence similaritiesi

Belongs to the immunoglobulin superfamily. ICAM family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IPHM Eukaryota
ENOG410YQ1Q LUCA
GeneTreeiENSGT00530000063246
HOGENOMiHOG000059554
HOVERGENiHBG052074
InParanoidiP13597
KOiK06490
OMAiQTLRCQA
OrthoDBiEOG091G022Y
PhylomeDBiP13597
TreeFamiTF333745

Family and domain databases

Gene3Di2.60.40.10, 5 hits
InterProiView protein in InterPro
IPR003988 ICAM
IPR013768 ICAM_N
IPR003987 ICAM_VCAM_N
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
PfamiView protein in Pfam
PF03921 ICAM_N, 1 hit
PF13895 Ig_2, 1 hit
PRINTSiPR01473 ICAM
PR01472 ICAMVCAM1
SMARTiView protein in SMART
SM00409 IG, 4 hits
SUPFAMiSSF48726 SSF48726, 5 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P13597-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASTRAKPTL PLLLALVTVV IPGPGDAQVS IHPREAFLPQ GGSVQVNCSS
60 70 80 90 100
SCKEDLSLGL ETQWLKDELE SGPNWKLFEL SEIGEDSSPL CFENCGTVQS
110 120 130 140 150
SASATITVYS FPESVELRPL PAWQQVGKDL TLRCHVDGGA PRTQLSAVLL
160 170 180 190 200
RGEEILSRQP VGGHPKDPKE ITFTVLASRG DHGANFSCRT ELDLRPQGLA
210 220 230 240 250
LFSNVSEARS LRTFDLPATI PKLDTPDLLE VGTQQKLFCS LEGLFPASEA
260 270 280 290 300
RIYLELGGQM PTQESTNSSD SVSATALVEV TEEFDRTLPL RCVLELADQI
310 320 330 340 350
LETQRTLTVY NFSAPVLTLS QLEVSEGSQV TVKCEAHSGS KVVLLSGVEP
360 370 380 390 400
RPPTPQVQFT LNASSEDHKR SFFCSAALEV AGKFLFKNQT LELHVLYGPR
410 420 430 440 450
LDETDCLGNW TWQEGSQQTL KCQAWGNPSP KMTCRRKADG ALLPIGVVKS
460 470 480 490 500
VKQEMNGTYV CHAFSSHGNV TRNVYLTVLY HSQNNWTIII LVPVLLVIVG
510 520 530
LVMAASYVYN RQRKIRIYKL QKAQEEAIKL KGQAPPP
Length:537
Mass (Da):58,844
Last modified:January 1, 1990 - v1
Checksum:i6124167753774555
GO
Isoform 2 (identifier: P13597-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MASTRAKPTLPLLLALVTVVIPGPGDAQVSIHPR → MITHRHPVREKSINSYQFIKEKQFPAEN

Show »
Length:531
Mass (Da):58,753
Checksum:i23B6CCDA9313761F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti243G → A in AAA37876 (PubMed:2479693).Curated1
Sequence conflicti370R → A in CAA34621 (PubMed:2573511).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0025181 – 34MASTR…SIHPR → MITHRHPVREKSINSYQFIK EKQFPAEN in isoform 2. CuratedAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X16624 mRNA Translation: CAA34621.1
X16625 mRNA Translation: CAA34622.1
M31585 mRNA Translation: AAA37876.1
X52264 mRNA Translation: CAA36507.1
M90551
, M90546, M90547, M90548, M90549, M90550 Genomic DNA Translation: AAA37875.1
X54331 mRNA No translation available.
CCDSiCCDS22889.1 [P13597-1]
PIRiA45815
I49769
S06016
RefSeqiNP_034623.1, NM_010493.3 [P13597-1]
UniGeneiMm.435508

Genome annotation databases

EnsembliENSMUST00000086399; ENSMUSP00000083587; ENSMUSG00000037405 [P13597-1]
GeneIDi15894
KEGGimmu:15894
UCSCiuc009ojx.1 mouse [P13597-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

ICAM-1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X16624 mRNA Translation: CAA34621.1
X16625 mRNA Translation: CAA34622.1
M31585 mRNA Translation: AAA37876.1
X52264 mRNA Translation: CAA36507.1
M90551
, M90546, M90547, M90548, M90549, M90550 Genomic DNA Translation: AAA37875.1
X54331 mRNA No translation available.
CCDSiCCDS22889.1 [P13597-1]
PIRiA45815
I49769
S06016
RefSeqiNP_034623.1, NM_010493.3 [P13597-1]
UniGeneiMm.435508

3D structure databases

ProteinModelPortaliP13597
SMRiP13597
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-29096N
IntActiP13597, 2 interactors
MINTiP13597
STRINGi10090.ENSMUSP00000083587

PTM databases

iPTMnetiP13597
PhosphoSitePlusiP13597

Proteomic databases

PaxDbiP13597
PeptideAtlasiP13597
PRIDEiP13597

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000086399; ENSMUSP00000083587; ENSMUSG00000037405 [P13597-1]
GeneIDi15894
KEGGimmu:15894
UCSCiuc009ojx.1 mouse [P13597-1]

Organism-specific databases

CTDi3383
MGIiMGI:96392 Icam1

Phylogenomic databases

eggNOGiENOG410IPHM Eukaryota
ENOG410YQ1Q LUCA
GeneTreeiENSGT00530000063246
HOGENOMiHOG000059554
HOVERGENiHBG052074
InParanoidiP13597
KOiK06490
OMAiQTLRCQA
OrthoDBiEOG091G022Y
PhylomeDBiP13597
TreeFamiTF333745

Enzyme and pathway databases

ReactomeiR-MMU-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-MMU-216083 Integrin cell surface interactions

Miscellaneous databases

ChiTaRSiIcam1 mouse
PROiPR:P13597
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000037405 Expressed in 212 organ(s), highest expression level in lung
CleanExiMM_ICAM1
ExpressionAtlasiP13597 baseline and differential
GenevisibleiP13597 MM

Family and domain databases

Gene3Di2.60.40.10, 5 hits
InterProiView protein in InterPro
IPR003988 ICAM
IPR013768 ICAM_N
IPR003987 ICAM_VCAM_N
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
PfamiView protein in Pfam
PF03921 ICAM_N, 1 hit
PF13895 Ig_2, 1 hit
PRINTSiPR01473 ICAM
PR01472 ICAMVCAM1
SMARTiView protein in SMART
SM00409 IG, 4 hits
SUPFAMiSSF48726 SSF48726, 5 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiICAM1_MOUSE
AccessioniPrimary (citable) accession number: P13597
Secondary accession number(s): Q61828
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: January 1, 1990
Last modified: September 12, 2018
This is version 189 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again