Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - P13597 (ICAM1_MOUSE)

Entry version 212 (25 May 2022)
Sequence version 1 (01 Jan 1990)
Previous versions | rss
Add a publicationFeedback
Protein

Intercellular adhesion molecule 1

Gene

Icam1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation (By similarity).

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-MMU-216083, Integrin cell surface interactions

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Intercellular adhesion molecule 1
Short name:
ICAM-1
Alternative name(s):
MALA-2
MyD10
CD_antigen: CD54
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Icam1
Synonyms:Icam-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:96392, Icam1

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSMUSG00000037405

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini28 – 485ExtracellularSequence analysisAdd BLAST458
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei486 – 509HelicalSequence analysisAdd BLAST24
Topological domaini510 – 537CytoplasmicSequence analysisAdd BLAST28

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Spontaneous onset of obesity in 16-week old mice with higher levels of white and brown fat and a slightly heavier liver. Enhanced susceptibility to high fat diet-induced obesity characterized by a weight increase and higher levels of white and brown fat.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 27By similarityAdd BLAST27
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001478528 – 537Intercellular adhesion molecule 1Add BLAST510

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi47N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi48 ↔ 91PROSITE-ProRule annotation
Disulfide bondi52 ↔ 95PROSITE-ProRule annotation
Disulfide bondi134 ↔ 188PROSITE-ProRule annotation
Glycosylationi185N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi204N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi239 ↔ 292PROSITE-ProRule annotation
Glycosylationi267N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi311N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi334 ↔ 374PROSITE-ProRule annotation
Glycosylationi362N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi388N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi406 ↔ 422By similarity
Glycosylationi409N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi422 ↔ 461PROSITE-ProRule annotation
Disulfide bondi434 ↔ 461By similarity
Glycosylationi456N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi469N-linked (GlcNAc...) asparagine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Monoubiquitinated, which is promoted by MARCH9 and leads to endocytosis.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei469Not glycosylated1 Publication1
Sitei485Not glycosylated1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein, Ubl conjugation

Proteomic databases

The CPTAC Assay portal

More...CPTACi		non-CPTAC-3362

Encyclopedia of Proteome Dynamics

More...EPDi		P13597

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P13597

MaxQB - The MaxQuant DataBase

More...MaxQBi		P13597

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P13597

PeptideAtlas

More...PeptideAtlasi		P13597

PRoteomics IDEntifications database

More...PRIDEi		P13597

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		269522 [P13597-1]
269523 [P13597-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P13597, 10 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P13597

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P13597

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at low level on a subpopulation of lymphocytes, macrophages, and endothelial cells, but is strongly induced on these cells, and on fibroblasts and epithelial cells.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000037405, Expressed in lung and 236 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P13597, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P13597, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Interacts with MUC1 and promotes cell aggregation in epithelial cells.

Interacts with ARHGEF26/SGEF.

Interacts (on T cell side) with CD81, CD247 and CD9 at immunological synapses between antigen-presenting cells and T cells.

By similarity

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

Database of interacting proteins

More...DIPi		DIP-29096N

Protein interaction database and analysis system

More...IntActi		P13597, 1 interactor

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000083587

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P13597, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		P13597

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P13597

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini41 – 102Ig-like C2-type 1Add BLAST62
Domaini127 – 195Ig-like C2-type 2Add BLAST69
Domaini232 – 299Ig-like C2-type 3Add BLAST68
Domaini327 – 381Ig-like C2-type 4Add BLAST55
Domaini415 – 468Ig-like C2-type 5Add BLAST54

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi151 – 153Cell attachment site; atypicalSequence analysis3
Motifi179 – 181Cell attachment siteSequence analysis3

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the immunoglobulin superfamily. ICAM family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S45R, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000162311

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_036160_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P13597

Identification of Orthologs from Complete Genome Data

More...OMAi		NLTVYWF

Database for complete collections of gene phylogenies

More...PhylomeDBi		P13597

TreeFam database of animal gene trees

More...TreeFami		TF333745

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 5 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR003988, ICAM
IPR013768, ICAM_N
IPR003987, ICAM_VCAM_N
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003599, Ig_sub

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03921, ICAM_N, 1 hit
PF13895, Ig_2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01473, ICAM
PR01472, ICAMVCAM1

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00409, IG, 4 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726, SSF48726, 5 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50835, IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P13597-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASTRAKPTL PLLLALVTVV IPGPGDAQVS IHPREAFLPQ GGSVQVNCSS 
        60         70         80         90        100
SCKEDLSLGL ETQWLKDELE SGPNWKLFEL SEIGEDSSPL CFENCGTVQS 
       110        120        130        140        150
SASATITVYS FPESVELRPL PAWQQVGKDL TLRCHVDGGA PRTQLSAVLL 
       160        170        180        190        200
RGEEILSRQP VGGHPKDPKE ITFTVLASRG DHGANFSCRT ELDLRPQGLA 
       210        220        230        240        250
LFSNVSEARS LRTFDLPATI PKLDTPDLLE VGTQQKLFCS LEGLFPASEA 
       260        270        280        290        300
RIYLELGGQM PTQESTNSSD SVSATALVEV TEEFDRTLPL RCVLELADQI 
       310        320        330        340        350
LETQRTLTVY NFSAPVLTLS QLEVSEGSQV TVKCEAHSGS KVVLLSGVEP 
       360        370        380        390        400
RPPTPQVQFT LNASSEDHKR SFFCSAALEV AGKFLFKNQT LELHVLYGPR 
       410        420        430        440        450
LDETDCLGNW TWQEGSQQTL KCQAWGNPSP KMTCRRKADG ALLPIGVVKS 
       460        470        480        490        500
VKQEMNGTYV CHAFSSHGNV TRNVYLTVLY HSQNNWTIII LVPVLLVIVG 
       510        520        530 
LVMAASYVYN RQRKIRIYKL QKAQEEAIKL KGQAPPP
Length:537
Mass (Da):58,844
Last modified:January 1, 1990 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6124167753774555
GO
Isoform 2 (identifier: P13597-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MASTRAKPTLPLLLALVTVVIPGPGDAQVSIHPR → MITHRHPVREKSINSYQFIKEKQFPAEN

Show »
Length:531
Mass (Da):58,753
Checksum:i23B6CCDA9313761F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti243G → A in AAA37876 (PubMed:2479693).Curated1
Sequence conflicti370R → A in CAA34621 (PubMed:2573511).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0025181 – 34MASTR…SIHPR → MITHRHPVREKSINSYQFIK EKQFPAEN in isoform 2. CuratedAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X16624 mRNA Translation: CAA34621.1
X16625 mRNA Translation: CAA34622.1
M31585 mRNA Translation: AAA37876.1
X52264 mRNA Translation: CAA36507.1
M90551 M90550 Genomic DNA Translation: AAA37875.1
X54331 mRNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS22889.1 [P13597-1]

Protein sequence database of the Protein Information Resource

More...PIRi		A45815
I49769
S06016

NCBI Reference Sequences

More...RefSeqi		NP_034623.1, NM_010493.3 [P13597-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000086399; ENSMUSP00000083587; ENSMUSG00000037405 [P13597-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		15894

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:15894

UCSC genome browser

More...UCSCi		uc009ojx.1, mouse [P13597-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Functional Glycomics Gateway - Glycan Binding

ICAM-1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X16624 mRNA Translation: CAA34621.1
X16625 mRNA Translation: CAA34622.1
M31585 mRNA Translation: AAA37876.1
X52264 mRNA Translation: CAA36507.1
M90551 M90550 Genomic DNA Translation: AAA37875.1
X54331 mRNA No translation available.
CCDSiCCDS22889.1 [P13597-1]
PIRiA45815
I49769
S06016
RefSeqiNP_034623.1, NM_010493.3 [P13597-1]

3D structure databases

AlphaFoldDBiP13597
SMRiP13597
ModBaseiSearch...

Protein-protein interaction databases

DIPiDIP-29096N
IntActiP13597, 1 interactor
STRINGi10090.ENSMUSP00000083587

PTM databases

GlyGeniP13597, 10 sites
iPTMnetiP13597
PhosphoSitePlusiP13597

Proteomic databases

CPTACinon-CPTAC-3362
EPDiP13597
jPOSTiP13597
MaxQBiP13597
PaxDbiP13597
PeptideAtlasiP13597
PRIDEiP13597
ProteomicsDBi269522 [P13597-1]
269523 [P13597-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		795, 3152 antibodies from 53 providers

The DNASU plasmid repository

More...DNASUi		15894

Genome annotation databases

EnsembliENSMUST00000086399; ENSMUSP00000083587; ENSMUSG00000037405 [P13597-1]
GeneIDi15894
KEGGimmu:15894
UCSCiuc009ojx.1, mouse [P13597-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3383
MGIiMGI:96392, Icam1
VEuPathDBiHostDB:ENSMUSG00000037405

Phylogenomic databases

eggNOGiENOG502S45R, Eukaryota
GeneTreeiENSGT00940000162311
HOGENOMiCLU_036160_1_1_1
InParanoidiP13597
OMAiNLTVYWF
PhylomeDBiP13597
TreeFamiTF333745

Enzyme and pathway databases

ReactomeiR-MMU-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-MMU-216083, Integrin cell surface interactions

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		15894, 5 hits in 75 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Icam1, mouse

Protein Ontology

More...PROi		PR:P13597
RNActiP13597, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000037405, Expressed in lung and 236 other tissues
ExpressionAtlasiP13597, baseline and differential
GenevisibleiP13597, MM

Family and domain databases

Gene3Di2.60.40.10, 5 hits
InterProiView protein in InterPro
IPR003988, ICAM
IPR013768, ICAM_N
IPR003987, ICAM_VCAM_N
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003599, Ig_sub
PfamiView protein in Pfam
PF03921, ICAM_N, 1 hit
PF13895, Ig_2, 1 hit
PRINTSiPR01473, ICAM
PR01472, ICAMVCAM1
SMARTiView protein in SMART
SM00409, IG, 4 hits
SUPFAMiSSF48726, SSF48726, 5 hits
PROSITEiView protein in PROSITE
PS50835, IG_LIKE, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiICAM1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P13597
Secondary accession number(s): Q61828
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: January 1, 1990
Last modified: May 25, 2022
This is version 212 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again