Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bone morphogenetic protein 1

Gene

BMP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cleaves the C-terminal propeptides of procollagen I, II and III. Induces cartilage and bone formation. May participate in dorsoventral patterning during early development by cleaving chordin (CHRD). Responsible for the proteolytic activation of lysyl oxidase LOX.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Cleavage of the C-terminal propeptide at Ala-|-Asp in type I and II procollagens and at Arg-|-Asp in type III. EC:3.4.24.19

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+PROSITE-ProRule annotation1 PublicationNote: Binds 1 zinc ion per subunit.PROSITE-ProRule annotation1 Publication

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activity is increased by the procollagen C-endopeptidase enhancer protein.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi213Zinc; via tele nitrogen; catalyticPROSITE-ProRule annotation1 Publication1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei214PROSITE-ProRule annotation1 Publication1
Metal bindingi217Zinc; via tele nitrogen; catalyticPROSITE-ProRule annotation1 Publication1
Metal bindingi223Zinc; via tele nitrogen; catalyticPROSITE-ProRule annotation1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • cytokine activity Source: UniProtKB-KW
  • growth factor activity Source: UniProtKB-KW
  • identical protein binding Source: IntAct
  • metalloendopeptidase activity Source: Reactome
  • metallopeptidase activity Source: UniProtKB
  • peptidase activity Source: UniProtKB
  • serine-type endopeptidase activity Source: Reactome
  • zinc ion binding Source: InterPro

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCytokine, Developmental protein, Growth factor, Hydrolase, Metalloprotease, Protease
Biological processChondrogenesis, Differentiation, Osteogenesis
LigandCalcium, Metal-binding, Zinc

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.4.24.19 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1474228 Degradation of the extracellular matrix
R-HSA-1650814 Collagen biosynthesis and modifying enzymes
R-HSA-2214320 Anchoring fibril formation
R-HSA-2243919 Crosslinking of collagen fibrils
R-HSA-8963896 HDL assembly

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M12.005

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Bone morphogenetic protein 1 (EC:3.4.24.19)
Short name:
BMP-1
Alternative name(s):
Mammalian tolloid protein
Short name:
mTld
Procollagen C-proteinase
Short name:
PCP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BMP1
Synonyms:PCOLC
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000168487.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1067 BMP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
112264 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P13497

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Extracellular matrix, Golgi apparatus, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Osteogenesis imperfecta 13 (OI13)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive form of osteogenesis imperfecta, a connective tissue disorder characterized by low bone mass, bone fragility and susceptibility to fractures after minimal trauma. Disease severity ranges from very mild forms without fractures to intrauterine fractures and perinatal lethality. Extraskeletal manifestations, which affect a variable number of patients, are dentinogenesis imperfecta, hearing loss, and blue sclerae. OI13 is characterized by normal teeth, faint blue sclerae, severe growth deficiency, borderline osteoporosis, severe bone deformity, and recurrent fractures affecting both upper and lower limbs.
See also OMIM:614856
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06909612G → R in OI13; the mutation leads to severely reduced post-translational N-glycosylation of the protein and impairs protein secretion; leads to both reduced secretion and subsequent reduced processing of the substrates CHRD and COL1A1. 1 PublicationCorresponds to variant dbSNP:rs318240762EnsemblClinVar.1
Natural variantiVAR_067224249F → L in OI13; leads to a protein with deficient procollagen I C-terminal propeptide proteolytic activity. 1 PublicationCorresponds to variant dbSNP:rs398122891EnsemblClinVar.1
Natural variantiVAR_072248270M → V in OI13; partial loss of activity. 1 PublicationCorresponds to variant dbSNP:rs786205219EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi119 – 120RR → AA: Doesn't abolish secretion. 1 Publication2

Keywords - Diseasei

Disease mutation, Osteogenesis imperfecta

Organism-specific databases

DisGeNET

More...
DisGeNETi
649

MalaCards human disease database

More...
MalaCardsi
BMP1
MIMi614856 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000168487

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
314029 High bone mass osteogenesis imperfecta
216812 Osteogenesis imperfecta type 3

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25377

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3898

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2333

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BMP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
13124688

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 22Sequence analysisAdd BLAST22
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000002888923 – 1201 PublicationAdd BLAST98
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000028890121 – 986Bone morphogenetic protein 1Add BLAST866

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi91N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi142N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi163 ↔ 319PROSITE-ProRule annotation1 Publication
Disulfide bondi183 ↔ 205PROSITE-ProRule annotation1 Publication
Disulfide bondi185 ↔ 186PROSITE-ProRule annotation1 Publication
Disulfide bondi322 ↔ 348By similarity
Glycosylationi332N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi363N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi375 ↔ 397By similarity
Disulfide bondi435 ↔ 461By similarity
Disulfide bondi488 ↔ 510By similarity
Disulfide bondi551 ↔ 563By similarity
Disulfide bondi559 ↔ 572By similarity
Disulfide bondi574 ↔ 587By similarity
Disulfide bondi591 ↔ 617By similarity
Glycosylationi599N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi644 ↔ 666By similarity
Disulfide bondi707 ↔ 718By similarity
Disulfide bondi714 ↔ 727By similarity
Disulfide bondi729 ↔ 742By similarity
Disulfide bondi747 ↔ 773By similarity
Disulfide bondi800 ↔ 822By similarity
Disulfide bondi860 ↔ 890By similarity
Disulfide bondi917 ↔ 939By similarity
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei934Omega-N-methylarginineBy similarity1
Modified residuei937Omega-N-methylarginineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytically activated in the trans-Golgi network by furin-like/paired basic proprotein convertases, cleavage is not required for secretion.1 Publication

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Methylation, Zymogen

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P13497

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P13497

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P13497

PeptideAtlas

More...
PeptideAtlasi
P13497

PRoteomics IDEntifications database

More...
PRIDEi
P13497

ProteomicsDB human proteome resource

More...
ProteomicsDBi
52914
52915 [P13497-2]
52916 [P13497-3]
52917 [P13497-4]
52918 [P13497-5]
52919 [P13497-6]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1045

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P13497

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P13497

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P13497

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000168487 Expressed in 197 organ(s), highest expression level in placenta

CleanEx database of gene expression profiles

More...
CleanExi
HS_BMP1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P13497 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P13497 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA014572

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with POSTN, the interaction promotes deposition on the extracellular matrix.By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107117, 45 interactors

Database of interacting proteins

More...
DIPi
DIP-33403N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P13497

Protein interaction database and analysis system

More...
IntActi
P13497, 14 interactors

Molecular INTeraction database

More...
MINTi
P13497

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000305714

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P13497

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1986
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3EDGX-ray1.27A121-321[»]
3EDHX-ray1.25A121-321[»]
6BSLX-ray1.45A/B121-321[»]
6BSMX-ray2.33A121-320[»]
6BTNX-ray2.05A/B121-321[»]
6BTOX-ray2.05A/B121-321[»]
6BTPX-ray1.93A/B121-320[»]
6BTQX-ray1.75A/B121-321[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P13497

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P13497

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P13497

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini121 – 320Peptidase M12APROSITE-ProRule annotationAdd BLAST200
Domaini322 – 434CUB 1PROSITE-ProRule annotationAdd BLAST113
Domaini435 – 546CUB 2PROSITE-ProRule annotationAdd BLAST112
Domaini547 – 588EGF-like 1; calcium-bindingPROSITE-ProRule annotationAdd BLAST42
Domaini591 – 703CUB 3PROSITE-ProRule annotationAdd BLAST113
Domaini704 – 743EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd BLAST40
Domaini747 – 859CUB 4PROSITE-ProRule annotationAdd BLAST113
Domaini860 – 976CUB 5PROSITE-ProRule annotationAdd BLAST117

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3714 Eukaryota
ENOG410ZPX7 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157176

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG004859

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P13497

KEGG Orthology (KO)

More...
KOi
K05502

Identification of Orthologs from Complete Genome Data

More...
OMAi
KGFEASH

Database of Orthologous Groups

More...
OrthoDBi
170905at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P13497

TreeFam database of animal gene trees

More...
TreeFami
TF314351

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00041 CUB, 5 hits
cd04281 ZnMc_BMP1_TLD, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.120.290, 5 hits
3.40.390.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015446 BMP_1/tolloid-like
IPR000859 CUB_dom
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR009030 Growth_fac_rcpt_cys_sf
IPR024079 MetalloPept_cat_dom_sf
IPR001506 Peptidase_M12A
IPR006026 Peptidase_Metallo
IPR035914 Sperma_CUB_dom_sf
IPR034036 ZnMP_TLD/BMP1

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01400 Astacin, 1 hit
PF00431 CUB, 5 hits
PF07645 EGF_CA, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001199 BMP_1/tolloid-like, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00480 ASTACIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00042 CUB, 5 hits
SM00181 EGF, 2 hits
SM00179 EGF_CA, 2 hits
SM00235 ZnMc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49854 SSF49854, 5 hits
SSF57184 SSF57184, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51864 ASTACIN, 1 hit
PS00010 ASX_HYDROXYL, 2 hits
PS01180 CUB, 5 hits
PS01186 EGF_2, 2 hits
PS50026 EGF_3, 2 hits
PS01187 EGF_CA, 2 hits
PS00142 ZINC_PROTEASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform BMP1-3 (identifier: P13497-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPGVARLPLL LGLLLLPRPG RPLDLADYTY DLAEEDDSEP LNYKDPCKAA
60 70 80 90 100
AFLGDIALDE EDLRAFQVQQ AVDLRRHTAR KSSIKAAVPG NTSTPSCQST
110 120 130 140 150
NGQPQRGACG RWRGRSRSRR AATSRPERVW PDGVIPFVIG GNFTGSQRAV
160 170 180 190 200
FRQAMRHWEK HTCVTFLERT DEDSYIVFTY RPCGCCSYVG RRGGGPQAIS
210 220 230 240 250
IGKNCDKFGI VVHELGHVVG FWHEHTRPDR DRHVSIVREN IQPGQEYNFL
260 270 280 290 300
KMEPQEVESL GETYDFDSIM HYARNTFSRG IFLDTIVPKY EVNGVKPPIG
310 320 330 340 350
QRTRLSKGDI AQARKLYKCP ACGETLQDST GNFSSPEYPN GYSAHMHCVW
360 370 380 390 400
RISVTPGEKI ILNFTSLDLY RSRLCWYDYV EVRDGFWRKA PLRGRFCGSK
410 420 430 440 450
LPEPIVSTDS RLWVEFRSSS NWVGKGFFAV YEAICGGDVK KDYGHIQSPN
460 470 480 490 500
YPDDYRPSKV CIWRIQVSEG FHVGLTFQSF EIERHDSCAY DYLEVRDGHS
510 520 530 540 550
ESSTLIGRYC GYEKPDDIKS TSSRLWLKFV SDGSINKAGF AVNFFKEVDE
560 570 580 590 600
CSRPNRGGCE QRCLNTLGSY KCSCDPGYEL APDKRRCEAA CGGFLTKLNG
610 620 630 640 650
SITSPGWPKE YPPNKNCIWQ LVAPTQYRIS LQFDFFETEG NDVCKYDFVE
660 670 680 690 700
VRSGLTADSK LHGKFCGSEK PEVITSQYNN MRVEFKSDNT VSKKGFKAHF
710 720 730 740 750
FSDKDECSKD NGGCQQDCVN TFGSYECQCR SGFVLHDNKH DCKEAGCDHK
760 770 780 790 800
VTSTSGTITS PNWPDKYPSK KECTWAISST PGHRVKLTFM EMDIESQPEC
810 820 830 840 850
AYDHLEVFDG RDAKAPVLGR FCGSKKPEPV LATGSRMFLR FYSDNSVQRK
860 870 880 890 900
GFQASHATEC GGQVRADVKT KDLYSHAQFG DNNYPGGVDC EWVIVAEEGY
910 920 930 940 950
GVELVFQTFE VEEETDCGYD YMELFDGYDS TAPRLGRYCG SGPPEEVYSA
960 970 980
GDSVLVKFHS DDTITKKGFH LRYTSTKFQD TLHSRK
Length:986
Mass (Da):111,249
Last modified:February 21, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF89201913AC3CBEA
GO
Isoform BMP1-1 (identifier: P13497-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     703-730: DKDECSKDNGGCQQDCVNTFGSYECQCR → EKRPALQPPRGRPHQLKFRVQKRNRTPQ
     731-986: Missing.

Show »
Length:730
Mass (Da):82,900
Checksum:iE506D63729A9E86D
GO
Isoform BMP1-2 (identifier: P13497-7)
Sequence is not available
Length:
Mass (Da):
Isoform BMP1-4 (identifier: P13497-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-302: QEYNFLKMEP...NGVKPPIGQR → VLHSSLLLLS...AAPRTLRAGV
     303-986: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:302
Mass (Da):33,424
Checksum:i9FCDE92B1F884B15
GO
Isoform BMP1-5 (identifier: P13497-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     589-622: AACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLV → GCYDLQVGKPLLWDRHCFRLSTHGPEMLGTALRG
     623-986: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:622
Mass (Da):70,469
Checksum:iA47CE9FD49D5A8D7
GO
Isoform BMP1-6 (identifier: P13497-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     703-717: DKDECSKDNGGCQQD → GGELFGLLGHPPRRP
     718-986: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:717
Mass (Da):81,082
Checksum:iAE07361E00A6A700
GO
Isoform BMP1-7 (identifier: P13497-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     703-823: DKDECSKDNG...KAPVLGRFCG → VLEGAGDRHS...PATFRGIWAL
     824-986: Missing.

Show »
Length:823
Mass (Da):92,655
Checksum:i09148B0724B5F1A8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3MIM8Q3MIM8_HUMAN
Metalloendopeptidase
BMP1
302Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZKR5B7ZKR5_HUMAN
BMP1 protein
BMP1
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RH22E5RH22_HUMAN
Bone morphogenetic protein 1
BMP1
63Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti748D → N in AAC41710 (PubMed:7798260).Curated1
Sequence conflicti934R → S in AAC41710 (PubMed:7798260).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06909612G → R in OI13; the mutation leads to severely reduced post-translational N-glycosylation of the protein and impairs protein secretion; leads to both reduced secretion and subsequent reduced processing of the substrates CHRD and COL1A1. 1 PublicationCorresponds to variant dbSNP:rs318240762EnsemblClinVar.1
Natural variantiVAR_03614145D → H in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_067224249F → L in OI13; leads to a protein with deficient procollagen I C-terminal propeptide proteolytic activity. 1 PublicationCorresponds to variant dbSNP:rs398122891EnsemblClinVar.1
Natural variantiVAR_072248270M → V in OI13; partial loss of activity. 1 PublicationCorresponds to variant dbSNP:rs786205219EnsemblClinVar.1
Natural variantiVAR_051584719V → I. Corresponds to variant dbSNP:rs11996036EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_005463245 – 302QEYNF…PIGQR → VLHSSLLLLSCGSRNGASFP CSLESSTHQALCWTGLFLRP SPFPRLPLAAPRTLRAGV in isoform BMP1-4. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_005464303 – 986Missing in isoform BMP1-4. 1 PublicationAdd BLAST684
Alternative sequenceiVSP_005465589 – 622AACGG…IWQLV → GCYDLQVGKPLLWDRHCFRL STHGPEMLGTALRG in isoform BMP1-5. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_005466623 – 986Missing in isoform BMP1-5. 2 PublicationsAdd BLAST364
Alternative sequenceiVSP_005469703 – 823DKDEC…GRFCG → VLEGAGDRHSHLSGLELLLC PHALVDTVPAPPSALHGDTH AHTHTHVHTHCPIAQETCRG PPLGASRLSPQGPGHLTLAP QEGSYLDFWDTHRGDPKPRR RRKSLKTFSLTPATFRGIWA L in isoform BMP1-7. CuratedAdd BLAST121
Alternative sequenceiVSP_005461703 – 730DKDEC…ECQCR → EKRPALQPPRGRPHQLKFRV QKRNRTPQ in isoform BMP1-1. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_005467703 – 717DKDEC…GCQQD → GGELFGLLGHPPRRP in isoform BMP1-6. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_005468718 – 986Missing in isoform BMP1-6. 1 PublicationAdd BLAST269
Alternative sequenceiVSP_005462731 – 986Missing in isoform BMP1-1. 1 PublicationAdd BLAST256
Alternative sequenceiVSP_005470824 – 986Missing in isoform BMP1-7. CuratedAdd BLAST163

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U50330 mRNA Translation: AAA93462.1
M22488 mRNA Translation: AAA51833.1
Y08723 mRNA Translation: CAA69973.1
Y08724 mRNA Translation: CAA69974.1
Y08725 mRNA Translation: CAA69975.1
L35278 mRNA Translation: AAC41703.1
L35279 mRNA Translation: AAC41710.1
AK291620 mRNA Translation: BAF84309.1
CH471080 Genomic DNA Translation: EAW63698.1
CH471080 Genomic DNA Translation: EAW63703.1
CH471080 Genomic DNA Translation: EAW63704.1
BC136679 mRNA Translation: AAI36680.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34856.1 [P13497-2]
CCDS6026.1 [P13497-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
A37278 BMHU1
A58788
B58788

NCBI Reference Sequences

More...
RefSeqi
NP_001190.1, NM_001199.3 [P13497-2]
NP_006120.1, NM_006129.4 [P13497-1]
XP_011542919.1, XM_011544617.1 [P13497-4]
XP_016869227.1, XM_017013738.1 [P13497-5]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.1274

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000306349; ENSP00000306121; ENSG00000168487 [P13497-2]
ENST00000306385; ENSP00000305714; ENSG00000168487 [P13497-1]
ENST00000471755; ENSP00000428665; ENSG00000168487 [P13497-4]
ENST00000520970; ENSP00000428332; ENSG00000168487 [P13497-2]
ENST00000521385; ENSP00000430406; ENSG00000168487 [P13497-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
649

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:649

UCSC genome browser

More...
UCSCi
uc003xbb.4 human [P13497-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U50330 mRNA Translation: AAA93462.1
M22488 mRNA Translation: AAA51833.1
Y08723 mRNA Translation: CAA69973.1
Y08724 mRNA Translation: CAA69974.1
Y08725 mRNA Translation: CAA69975.1
L35278 mRNA Translation: AAC41703.1
L35279 mRNA Translation: AAC41710.1
AK291620 mRNA Translation: BAF84309.1
CH471080 Genomic DNA Translation: EAW63698.1
CH471080 Genomic DNA Translation: EAW63703.1
CH471080 Genomic DNA Translation: EAW63704.1
BC136679 mRNA Translation: AAI36680.1
CCDSiCCDS34856.1 [P13497-2]
CCDS6026.1 [P13497-1]
PIRiA37278 BMHU1
A58788
B58788
RefSeqiNP_001190.1, NM_001199.3 [P13497-2]
NP_006120.1, NM_006129.4 [P13497-1]
XP_011542919.1, XM_011544617.1 [P13497-4]
XP_016869227.1, XM_017013738.1 [P13497-5]
UniGeneiHs.1274

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3EDGX-ray1.27A121-321[»]
3EDHX-ray1.25A121-321[»]
6BSLX-ray1.45A/B121-321[»]
6BSMX-ray2.33A121-320[»]
6BTNX-ray2.05A/B121-321[»]
6BTOX-ray2.05A/B121-321[»]
6BTPX-ray1.93A/B121-320[»]
6BTQX-ray1.75A/B121-321[»]
ProteinModelPortaliP13497
SMRiP13497
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107117, 45 interactors
DIPiDIP-33403N
ELMiP13497
IntActiP13497, 14 interactors
MINTiP13497
STRINGi9606.ENSP00000305714

Chemistry databases

BindingDBiP13497
ChEMBLiCHEMBL3898
GuidetoPHARMACOLOGYi2333

Protein family/group databases

MEROPSiM12.005

PTM databases

GlyConnecti1045
iPTMnetiP13497
PhosphoSitePlusiP13497

Polymorphism and mutation databases

BioMutaiBMP1
DMDMi13124688

Proteomic databases

EPDiP13497
jPOSTiP13497
PaxDbiP13497
PeptideAtlasiP13497
PRIDEiP13497
ProteomicsDBi52914
52915 [P13497-2]
52916 [P13497-3]
52917 [P13497-4]
52918 [P13497-5]
52919 [P13497-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306349; ENSP00000306121; ENSG00000168487 [P13497-2]
ENST00000306385; ENSP00000305714; ENSG00000168487 [P13497-1]
ENST00000471755; ENSP00000428665; ENSG00000168487 [P13497-4]
ENST00000520970; ENSP00000428332; ENSG00000168487 [P13497-2]
ENST00000521385; ENSP00000430406; ENSG00000168487 [P13497-5]
GeneIDi649
KEGGihsa:649
UCSCiuc003xbb.4 human [P13497-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
649
DisGeNETi649
EuPathDBiHostDB:ENSG00000168487.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BMP1
HGNCiHGNC:1067 BMP1
HPAiHPA014572
MalaCardsiBMP1
MIMi112264 gene
614856 phenotype
neXtProtiNX_P13497
OpenTargetsiENSG00000168487
Orphaneti314029 High bone mass osteogenesis imperfecta
216812 Osteogenesis imperfecta type 3
PharmGKBiPA25377

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3714 Eukaryota
ENOG410ZPX7 LUCA
GeneTreeiENSGT00940000157176
HOVERGENiHBG004859
InParanoidiP13497
KOiK05502
OMAiKGFEASH
OrthoDBi170905at2759
PhylomeDBiP13497
TreeFamiTF314351

Enzyme and pathway databases

BRENDAi3.4.24.19 2681
ReactomeiR-HSA-1474228 Degradation of the extracellular matrix
R-HSA-1650814 Collagen biosynthesis and modifying enzymes
R-HSA-2214320 Anchoring fibril formation
R-HSA-2243919 Crosslinking of collagen fibrils
R-HSA-8963896 HDL assembly

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
BMP1 human
EvolutionaryTraceiP13497

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Bone_morphogenetic_protein_1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
649
PMAP-CutDBiP13497

Protein Ontology

More...
PROi
PR:P13497

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000168487 Expressed in 197 organ(s), highest expression level in placenta
CleanExiHS_BMP1
ExpressionAtlasiP13497 baseline and differential
GenevisibleiP13497 HS

Family and domain databases

CDDicd00041 CUB, 5 hits
cd04281 ZnMc_BMP1_TLD, 1 hit
Gene3Di2.60.120.290, 5 hits
3.40.390.10, 1 hit
InterProiView protein in InterPro
IPR015446 BMP_1/tolloid-like
IPR000859 CUB_dom
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR009030 Growth_fac_rcpt_cys_sf
IPR024079 MetalloPept_cat_dom_sf
IPR001506 Peptidase_M12A
IPR006026 Peptidase_Metallo
IPR035914 Sperma_CUB_dom_sf
IPR034036 ZnMP_TLD/BMP1
PfamiView protein in Pfam
PF01400 Astacin, 1 hit
PF00431 CUB, 5 hits
PF07645 EGF_CA, 1 hit
PIRSFiPIRSF001199 BMP_1/tolloid-like, 1 hit
PRINTSiPR00480 ASTACIN
SMARTiView protein in SMART
SM00042 CUB, 5 hits
SM00181 EGF, 2 hits
SM00179 EGF_CA, 2 hits
SM00235 ZnMc, 1 hit
SUPFAMiSSF49854 SSF49854, 5 hits
SSF57184 SSF57184, 1 hit
PROSITEiView protein in PROSITE
PS51864 ASTACIN, 1 hit
PS00010 ASX_HYDROXYL, 2 hits
PS01180 CUB, 5 hits
PS01186 EGF_2, 2 hits
PS50026 EGF_3, 2 hits
PS01187 EGF_CA, 2 hits
PS00142 ZINC_PROTEASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBMP1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P13497
Secondary accession number(s): A8K6F5
, B2RN46, D3DSR0, Q13292, Q13872, Q14874, Q99421, Q99422, Q99423, Q9UL38
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: February 21, 2001
Last modified: January 16, 2019
This is version 213 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again