Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P13051 (UNG_HUMAN)

Entry version 218 (10 Feb 2021)
Sequence version 2 (10 Oct 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Uracil-DNA glycosylase

Gene

UNG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Hydrolyzes single-stranded DNA or mismatched double-stranded DNA and polynucleotides, releasing free uracil.UniRule annotation EC:3.2.2.27

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei154Proton acceptorUniRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
Biological processDNA damage, DNA repair, Host-virus interaction

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.2.2.27, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P13051

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-110328, Recognition and association of DNA glycosylase with site containing an affected pyrimidine [P13051-1]
R-HSA-110329, Cleavage of the damaged pyrimidine [P13051-1]
R-HSA-110357, Displacement of DNA glycosylase by APEX1 [P13051-1]

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		P13051

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uracil-DNA glycosylaseUniRule annotation (EC:3.2.2.27UniRule annotation)
Short name:
UDGUniRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UNGUniRule annotation
Synonyms:DGU, UNG1UniRule annotation, UNG15UniRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:12572, UNG

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		191525, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P13051

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000076248.10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Immunodeficiency with hyper-IgM 5 (HIGM5)2 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA rare immunodeficiency syndrome characterized by normal or elevated serum IgM levels with absence of IgG, IgA, and IgE. It results in a profound susceptibility to bacterial infections.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_017094251F → S in HIGM5; fully active and stable when expressed in E.coli; mistargeted to mitochondria rather than the nucleus. 2 PublicationsCorresponds to variant dbSNP:rs104894380EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi154D → E or N: Loss of activity. 1 Publication1
Mutagenesisi156Y → A, C or S: Thymine-DNA glycosylase activity. 1 Publication1
Mutagenesisi213N → D: Cytosine-DNA glycosylase activity. 1 Publication1

Keywords - Diseasei

Disease variant

Organism-specific databases

DisGeNET

More...DisGeNETi		7374

MalaCards human disease database

More...MalaCardsi		UNG
MIMi608106, phenotype

Open Targets

More...OpenTargetsi		ENSG00000076248

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		101092, Hyper-IgM syndrome type 5

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA364

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P13051, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3277

Drug and drug target database

More...DrugBanki		DB07116, 1-(2-DEOXY-5-O-PHOSPHONO-BETA-D-ERYTHRO-PENTOFURANOSYL)-4-METHYL-1H-INDOLE
DB07760, 3-[(1E,7E)-8-(2,6-dioxo-1,2,3,6-tetrahydropyrimidin-4-yl)-3,6-dioxa-2,7-diazaocta-1,7-dien-1-yl]benzoic acid
DB06990, 4-[(1E,7E)-8-(2,6-DIOXO-1,2,3,6-TETRAHYDROPYRIMIDIN-4-YL)-3,6-DIOXA-2,7-DIAZAOCTA-1,7-DIEN-1-YL]BENZOIC ACID

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		UNG

Domain mapping of disease mutations (DMDM)

More...DMDMi		37999897

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001761731 – 313Uracil-DNA glycosylaseAdd BLAST313

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei12PhosphoserineCombined sources1
Modified residuei14PhosphoserineCombined sources1
Modified residuei23PhosphoserineCombined sources1
Modified residuei60PhosphothreonineCombined sources1
Modified residuei64PhosphoserineCombined sources1
Modified residuei295N6-acetyllysineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Isoform 1 is processed by cleavage of a transit peptide.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P13051

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P13051

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P13051

MaxQB - The MaxQuant DataBase

More...MaxQBi		P13051

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P13051

PeptideAtlas

More...PeptideAtlasi		P13051

PRoteomics IDEntifications database

More...PRIDEi		P13051

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		52891 [P13051-1]
52892 [P13051-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P13051

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P13051

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is widely expressed with the highest expression in skeletal muscle, heart and testicles. Isoform 2 has the highest expression levels in tissues containing proliferating cells.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000076248, Expressed in secondary oocyte and 241 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P13051, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P13051, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000076248, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

Interacts with FAM72A.

UniRule annotation1 Publication

(Microbial infection) Interacts with HIV-1 Vpr.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		113220, 27 interactors

Database of interacting proteins

More...DIPi		DIP-24194N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		P13051

Protein interaction database and analysis system

More...IntActi		P13051, 31 interactors

Molecular INTeraction database

More...MINTi		P13051

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000242576

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P13051

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P13051, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1313
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P13051

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P13051

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 25FAM72A-bindingAdd BLAST25

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the uracil-DNA glycosylase (UDG) superfamily. UNG family.UniRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2994, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000003405

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_032162_2_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P13051

Identification of Orthologs from Complete Genome Data

More...OMAi		PDNGYLM

Database of Orthologous Groups

More...OrthoDBi		1132313at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P13051

TreeFam database of animal gene trees

More...TreeFami		TF315028

Family and domain databases

Conserved Domains Database

More...CDDi		cd10027, UDG_F1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.470.10, 1 hit

HAMAP database of protein families

More...HAMAPi		MF_00148, UDG, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002043, UDG_fam1
IPR018085, Ura-DNA_Glyclase_AS
IPR005122, Uracil-DNA_glycosylase-like
IPR036895, Uracil-DNA_glycosylase-like_sf

The PANTHER Classification System

More...PANTHERi		PTHR11264, PTHR11264, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03167, UDG, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00986, UDG, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52141, SSF52141, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00628, ung, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00130, U_DNA_GLYCOSYLASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: P13051-1) [UniParc]FASTAAdd to basket
Also known as: UNG2

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIGQKTLYSF FSPSPARKRH APSPEPAVQG TGVAGVPEES GDAAAIPAKK 
        60         70         80         90        100
APAGQEEPGT PPSSPLSAEQ LDRIQRNKAA ALLRLAARNV PVGFGESWKK 
       110        120        130        140        150
HLSGEFGKPY FIKLMGFVAE ERKHYTVYPP PHQVFTWTQM CDIKDVKVVI 
       160        170        180        190        200
LGQDPYHGPN QAHGLCFSVQ RPVPPPPSLE NIYKELSTDI EDFVHPGHGD 
       210        220        230        240        250
LSGWAKQGVL LLNAVLTVRA HQANSHKERG WEQFTDAVVS WLNQNSNGLV 
       260        270        280        290        300
FLLWGSYAQK KGSAIDRKRH HVLQTAHPSP LSVYRGFFGC RHFSKTNELL 
       310 
QKSGKKPIDW KEL
Length:313
Mass (Da):34,645
Last modified:October 10, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA4B27E6198AFE9C0
GO
Isoform 1 (identifier: P13051-2) [UniParc]FASTAAdd to basket
Also known as: UNG1

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MIGQKTLYSF...GVPEESGDAA → MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQ

Show »
Length:304
Mass (Da):33,924
Checksum:i32998C244E47B215
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GYA2F5GYA2_HUMAN
Uracil-DNA glycosylase
UNG
258Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q68DM5Q68DM5_HUMAN
Uracil-DNA glycosylase
UNG DKFZp781L1143
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0526974Q → R. Corresponds to variant dbSNP:rs7488798Ensembl.1
Natural variantiVAR_017094251F → S in HIGM5; fully active and stable when expressed in E.coli; mistargeted to mitochondria rather than the nucleus. 2 PublicationsCorresponds to variant dbSNP:rs104894380EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0085131 – 44MIGQK…SGDAA → MGVFCLGPWGLGRKLRTPGK GPLQLLSRLCGDHLQ in isoform 1. 3 PublicationsAdd BLAST44

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X15653 mRNA Translation: CAA33679.1
X89398 Genomic DNA Translation: CAA61578.1
X89398 Genomic DNA Translation: CAA61579.1
Y09008 mRNA Translation: CAA70211.1
AF526277 Genomic DNA Translation: AAM77695.1
AK291341 mRNA Translation: BAF84030.1
AK313552 mRNA Translation: BAG36328.1
CH471054 Genomic DNA Translation: EAW97846.1
CH471054 Genomic DNA Translation: EAW97847.1
BC015205 mRNA Translation: AAH15205.1
BC050634 mRNA Translation: AAH50634.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS9124.1 [P13051-1]
CCDS9125.1 [P13051-2]

Protein sequence database of the Protein Information Resource

More...PIRi		S05964, A60472

NCBI Reference Sequences

More...RefSeqi		NP_003353.1, NM_003362.3 [P13051-2]
NP_550433.1, NM_080911.2 [P13051-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000242576; ENSP00000242576; ENSG00000076248 [P13051-1]
ENST00000336865; ENSP00000337398; ENSG00000076248 [P13051-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7374

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7374

UCSC genome browser

More...UCSCi		uc001tnz.3, human [P13051-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs
UNGbase

UNG mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X15653 mRNA Translation: CAA33679.1
X89398 Genomic DNA Translation: CAA61578.1
X89398 Genomic DNA Translation: CAA61579.1
Y09008 mRNA Translation: CAA70211.1
AF526277 Genomic DNA Translation: AAM77695.1
AK291341 mRNA Translation: BAF84030.1
AK313552 mRNA Translation: BAG36328.1
CH471054 Genomic DNA Translation: EAW97846.1
CH471054 Genomic DNA Translation: EAW97847.1
BC015205 mRNA Translation: AAH15205.1
BC050634 mRNA Translation: AAH50634.1
CCDSiCCDS9124.1 [P13051-1]
CCDS9125.1 [P13051-2]
PIRiS05964, A60472
RefSeqiNP_003353.1, NM_003362.3 [P13051-2]
NP_550433.1, NM_080911.2 [P13051-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AKZX-ray1.57A94-313[»]
1DPUNMR-B73-88[»]
1EMHX-ray1.80A94-313[»]
1EMJX-ray2.00A94-313[»]
1Q3FX-ray1.90A94-313[»]
1SSPX-ray1.90E94-313[»]
1UGHX-ray1.90E94-313[»]
1YUOX-ray1.95A91-313[»]
2HXMX-ray1.30A94-313[»]
2OXMX-ray2.50A94-313[»]
2OYTX-ray2.00A94-313[»]
2SSPX-ray2.25E94-313[»]
3FCFX-ray1.84A94-313[»]
3FCIX-ray1.27A94-313[»]
3FCKX-ray1.64B94-313[»]
3FCLX-ray1.70A/B94-313[»]
3TKBX-ray1.50A94-313[»]
4SKNX-ray2.90E94-313[»]
5AYRX-ray2.40A/C94-313[»]
5JK7X-ray3.49D/G94-313[»]
SMRiP13051
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi113220, 27 interactors
DIPiDIP-24194N
ELMiP13051
IntActiP13051, 31 interactors
MINTiP13051
STRINGi9606.ENSP00000242576

Chemistry databases

BindingDBiP13051
ChEMBLiCHEMBL3277
DrugBankiDB07116, 1-(2-DEOXY-5-O-PHOSPHONO-BETA-D-ERYTHRO-PENTOFURANOSYL)-4-METHYL-1H-INDOLE
DB07760, 3-[(1E,7E)-8-(2,6-dioxo-1,2,3,6-tetrahydropyrimidin-4-yl)-3,6-dioxa-2,7-diazaocta-1,7-dien-1-yl]benzoic acid
DB06990, 4-[(1E,7E)-8-(2,6-DIOXO-1,2,3,6-TETRAHYDROPYRIMIDIN-4-YL)-3,6-DIOXA-2,7-DIAZAOCTA-1,7-DIEN-1-YL]BENZOIC ACID

PTM databases

iPTMnetiP13051
PhosphoSitePlusiP13051

Genetic variation databases

BioMutaiUNG
DMDMi37999897

Proteomic databases

EPDiP13051
jPOSTiP13051
MassIVEiP13051
MaxQBiP13051
PaxDbiP13051
PeptideAtlasiP13051
PRIDEiP13051
ProteomicsDBi52891 [P13051-1]
52892 [P13051-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3173, 509 antibodies

The DNASU plasmid repository

More...DNASUi		7374

Genome annotation databases

EnsembliENST00000242576; ENSP00000242576; ENSG00000076248 [P13051-1]
ENST00000336865; ENSP00000337398; ENSG00000076248 [P13051-2]
GeneIDi7374
KEGGihsa:7374
UCSCiuc001tnz.3, human [P13051-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7374
DisGeNETi7374

GeneCards: human genes, protein and diseases

More...GeneCardsi		UNG
HGNCiHGNC:12572, UNG
HPAiENSG00000076248, Low tissue specificity
MalaCardsiUNG
MIMi191525, gene
608106, phenotype
neXtProtiNX_P13051
OpenTargetsiENSG00000076248
Orphaneti101092, Hyper-IgM syndrome type 5
PharmGKBiPA364
VEuPathDBiHostDB:ENSG00000076248.10

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2994, Eukaryota
GeneTreeiENSGT00390000003405
HOGENOMiCLU_032162_2_1_1
InParanoidiP13051
OMAiPDNGYLM
OrthoDBi1132313at2759
PhylomeDBiP13051
TreeFamiTF315028

Enzyme and pathway databases

BRENDAi3.2.2.27, 2681
PathwayCommonsiP13051
ReactomeiR-HSA-110328, Recognition and association of DNA glycosylase with site containing an affected pyrimidine [P13051-1]
R-HSA-110329, Cleavage of the damaged pyrimidine [P13051-1]
R-HSA-110357, Displacement of DNA glycosylase by APEX1 [P13051-1]
SABIO-RKiP13051

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		7374, 9 hits in 881 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		UNG, human
EvolutionaryTraceiP13051

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Uracil-DNA_glycosylase

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7374
PharosiP13051, Tbio

Protein Ontology

More...PROi		PR:P13051
RNActiP13051, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000076248, Expressed in secondary oocyte and 241 other tissues
ExpressionAtlasiP13051, baseline and differential
GenevisibleiP13051, HS

Family and domain databases

CDDicd10027, UDG_F1, 1 hit
Gene3Di3.40.470.10, 1 hit
HAMAPiMF_00148, UDG, 1 hit
InterProiView protein in InterPro
IPR002043, UDG_fam1
IPR018085, Ura-DNA_Glyclase_AS
IPR005122, Uracil-DNA_glycosylase-like
IPR036895, Uracil-DNA_glycosylase-like_sf
PANTHERiPTHR11264, PTHR11264, 1 hit
PfamiView protein in Pfam
PF03167, UDG, 1 hit
SMARTiView protein in SMART
SM00986, UDG, 1 hit
SUPFAMiSSF52141, SSF52141, 1 hit
TIGRFAMsiTIGR00628, ung, 1 hit
PROSITEiView protein in PROSITE
PS00130, U_DNA_GLYCOSYLASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUNG_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P13051
Secondary accession number(s): A8K5M6
, B2R8Y1, O00637, O00719, Q93028
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: October 10, 2003
Last modified: February 10, 2021
This is version 218 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again