Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 207 (13 Feb 2019)
Sequence version 2 (10 Oct 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Uracil-DNA glycosylase

Gene

UNG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Hydrolyzes single-stranded DNA or mismatched double-stranded DNA and polynucleotides, releasing free uracil.UniRule annotation EC:3.2.2.27

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei154Proton acceptorUniRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
Biological processDNA damage, DNA repair, Host-virus interaction

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.2.2.27 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-110328 Recognition and association of DNA glycosylase with site containing an affected pyrimidine
R-HSA-110329 Cleavage of the damaged pyrimidine
R-HSA-110357 Displacement of DNA glycosylase by APEX1

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
P13051

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uracil-DNA glycosylaseUniRule annotation (EC:3.2.2.27UniRule annotation)
Short name:
UDGUniRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UNGUniRule annotation
Synonyms:DGU, UNG1UniRule annotation, UNG15UniRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000076248.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12572 UNG

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
191525 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P13051

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Immunodeficiency with hyper-IgM 5 (HIGM5)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA rare immunodeficiency syndrome characterized by normal or elevated serum IgM levels with absence of IgG, IgA, and IgE. It results in a profound susceptibility to bacterial infections.
See also OMIM:608106
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_017094251F → S in HIGM5; fully active and stable when expressed in E.coli; mistargeted to mitochondria rather than the nucleus. 2 PublicationsCorresponds to variant dbSNP:rs104894380EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi154D → E or N: Loss of activity. 1 Publication1
Mutagenesisi156Y → A, C or S: Thymine-DNA glycosylase activity. 1 Publication1
Mutagenesisi213N → D: Cytosine-DNA glycosylase activity. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
7374

MalaCards human disease database

More...
MalaCardsi
UNG
MIMi608106 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000076248

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
101092 Hyper-IgM syndrome type 5

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA364

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3277

Drug and drug target database

More...
DrugBanki
DB07116 1-(2-DEOXY-5-O-PHOSPHONO-BETA-D-ERYTHRO-PENTOFURANOSYL)-4-METHYL-1H-INDOLE

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UNG

Domain mapping of disease mutations (DMDM)

More...
DMDMi
37999897

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001761731 – 313Uracil-DNA glycosylaseAdd BLAST313

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei12PhosphoserineCombined sources1
Modified residuei14PhosphoserineCombined sources1
Modified residuei23PhosphoserineCombined sources1
Modified residuei60PhosphothreonineCombined sources1
Modified residuei64PhosphoserineCombined sources1
Modified residuei295N6-acetyllysineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Isoform 1 is processed by cleavage of a transit peptide.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P13051

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P13051

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P13051

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P13051

PeptideAtlas

More...
PeptideAtlasi
P13051

PRoteomics IDEntifications database

More...
PRIDEi
P13051

ProteomicsDB human proteome resource

More...
ProteomicsDBi
52891
52892 [P13051-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P13051

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P13051

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is widely expressed with the highest expression in skeletal muscle, heart and testicles. Isoform 2 has the highest expression levels in tissues containing proliferating cells.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000076248 Expressed in 229 organ(s), highest expression level in secondary oocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P13051 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P13051 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB011605

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer. Interacts with FAM72A.UniRule annotation1 Publication
(Microbial infection) Interacts with HIV-1 Vpr.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
RPA2P159276EBI-1025947,EBI-621404

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
113220, 23 interactors

Database of interacting proteins

More...
DIPi
DIP-24194N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P13051

Protein interaction database and analysis system

More...
IntActi
P13051, 11 interactors

Molecular INTeraction database

More...
MINTi
P13051

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000242576

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P13051

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1313
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AKZX-ray1.57A94-313[»]
1DPUNMR-B73-88[»]
1EMHX-ray1.80A94-313[»]
1EMJX-ray2.00A94-313[»]
1Q3FX-ray1.90A94-313[»]
1SSPX-ray1.90E94-313[»]
1UGHX-ray1.90E94-313[»]
1YUOX-ray1.95A91-313[»]
2HXMX-ray1.30A94-313[»]
2OXMX-ray2.50A94-313[»]
2OYTX-ray2.00A94-313[»]
2SSPX-ray2.25E94-313[»]
3FCFX-ray1.84A94-313[»]
3FCIX-ray1.27A94-313[»]
3FCKX-ray1.64B94-313[»]
3FCLX-ray1.70A/B94-313[»]
3TKBX-ray1.50A94-313[»]
4SKNX-ray2.90E94-313[»]
5AYRX-ray2.40A/C94-313[»]
5JK7X-ray3.49D/G94-313[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P13051

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P13051

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P13051

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 25FAM72A-bindingAdd BLAST25

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the uracil-DNA glycosylase (UDG) superfamily. UNG family.UniRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2994 Eukaryota
COG0692 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000003405

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000229528

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000396

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P13051

KEGG Orthology (KO)

More...
KOi
K03648

Identification of Orthologs from Complete Genome Data

More...
OMAi
DNGYLMP

Database of Orthologous Groups

More...
OrthoDBi
1132313at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P13051

TreeFam database of animal gene trees

More...
TreeFami
TF315028

Family and domain databases

Conserved Domains Database

More...
CDDi
cd10027 UDG_F1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.470.10, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_00148 UDG, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002043 UDG_fam1
IPR018085 Ura-DNA_Glyclase_AS
IPR005122 Uracil-DNA_glycosylase-like
IPR036895 Uracil-DNA_glycosylase-like_sf

The PANTHER Classification System

More...
PANTHERi
PTHR11264 PTHR11264, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03167 UDG, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00986 UDG, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52141 SSF52141, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00628 ung, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00130 U_DNA_GLYCOSYLASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: P13051-1) [UniParc]FASTAAdd to basket
Also known as: UNG2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIGQKTLYSF FSPSPARKRH APSPEPAVQG TGVAGVPEES GDAAAIPAKK
60 70 80 90 100
APAGQEEPGT PPSSPLSAEQ LDRIQRNKAA ALLRLAARNV PVGFGESWKK
110 120 130 140 150
HLSGEFGKPY FIKLMGFVAE ERKHYTVYPP PHQVFTWTQM CDIKDVKVVI
160 170 180 190 200
LGQDPYHGPN QAHGLCFSVQ RPVPPPPSLE NIYKELSTDI EDFVHPGHGD
210 220 230 240 250
LSGWAKQGVL LLNAVLTVRA HQANSHKERG WEQFTDAVVS WLNQNSNGLV
260 270 280 290 300
FLLWGSYAQK KGSAIDRKRH HVLQTAHPSP LSVYRGFFGC RHFSKTNELL
310
QKSGKKPIDW KEL
Length:313
Mass (Da):34,645
Last modified:October 10, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA4B27E6198AFE9C0
GO
Isoform 1 (identifier: P13051-2) [UniParc]FASTAAdd to basket
Also known as: UNG1

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MIGQKTLYSF...GVPEESGDAA → MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQ

Show »
Length:304
Mass (Da):33,924
Checksum:i32998C244E47B215
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GYA2F5GYA2_HUMAN
Uracil-DNA glycosylase
UNG
258Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q68DM5Q68DM5_HUMAN
Uracil-DNA glycosylase
UNG DKFZp781L1143
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0526974Q → R. Corresponds to variant dbSNP:rs7488798Ensembl.1
Natural variantiVAR_017094251F → S in HIGM5; fully active and stable when expressed in E.coli; mistargeted to mitochondria rather than the nucleus. 2 PublicationsCorresponds to variant dbSNP:rs104894380EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0085131 – 44MIGQK…SGDAA → MGVFCLGPWGLGRKLRTPGK GPLQLLSRLCGDHLQ in isoform 1. 3 PublicationsAdd BLAST44

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X15653 mRNA Translation: CAA33679.1
X89398 Genomic DNA Translation: CAA61578.1
X89398 Genomic DNA Translation: CAA61579.1
Y09008 mRNA Translation: CAA70211.1
AF526277 Genomic DNA Translation: AAM77695.1
AK291341 mRNA Translation: BAF84030.1
AK313552 mRNA Translation: BAG36328.1
CH471054 Genomic DNA Translation: EAW97846.1
CH471054 Genomic DNA Translation: EAW97847.1
BC015205 mRNA Translation: AAH15205.1
BC050634 mRNA Translation: AAH50634.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS9124.1 [P13051-1]
CCDS9125.1 [P13051-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
S05964 A60472

NCBI Reference Sequences

More...
RefSeqi
NP_003353.1, NM_003362.3 [P13051-2]
NP_550433.1, NM_080911.2 [P13051-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.191334

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000242576; ENSP00000242576; ENSG00000076248 [P13051-1]
ENST00000336865; ENSP00000337398; ENSG00000076248 [P13051-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7374

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7374

UCSC genome browser

More...
UCSCi
uc001tnz.3 human [P13051-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs
UNGbase

UNG mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X15653 mRNA Translation: CAA33679.1
X89398 Genomic DNA Translation: CAA61578.1
X89398 Genomic DNA Translation: CAA61579.1
Y09008 mRNA Translation: CAA70211.1
AF526277 Genomic DNA Translation: AAM77695.1
AK291341 mRNA Translation: BAF84030.1
AK313552 mRNA Translation: BAG36328.1
CH471054 Genomic DNA Translation: EAW97846.1
CH471054 Genomic DNA Translation: EAW97847.1
BC015205 mRNA Translation: AAH15205.1
BC050634 mRNA Translation: AAH50634.1
CCDSiCCDS9124.1 [P13051-1]
CCDS9125.1 [P13051-2]
PIRiS05964 A60472
RefSeqiNP_003353.1, NM_003362.3 [P13051-2]
NP_550433.1, NM_080911.2 [P13051-1]
UniGeneiHs.191334

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AKZX-ray1.57A94-313[»]
1DPUNMR-B73-88[»]
1EMHX-ray1.80A94-313[»]
1EMJX-ray2.00A94-313[»]
1Q3FX-ray1.90A94-313[»]
1SSPX-ray1.90E94-313[»]
1UGHX-ray1.90E94-313[»]
1YUOX-ray1.95A91-313[»]
2HXMX-ray1.30A94-313[»]
2OXMX-ray2.50A94-313[»]
2OYTX-ray2.00A94-313[»]
2SSPX-ray2.25E94-313[»]
3FCFX-ray1.84A94-313[»]
3FCIX-ray1.27A94-313[»]
3FCKX-ray1.64B94-313[»]
3FCLX-ray1.70A/B94-313[»]
3TKBX-ray1.50A94-313[»]
4SKNX-ray2.90E94-313[»]
5AYRX-ray2.40A/C94-313[»]
5JK7X-ray3.49D/G94-313[»]
ProteinModelPortaliP13051
SMRiP13051
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113220, 23 interactors
DIPiDIP-24194N
ELMiP13051
IntActiP13051, 11 interactors
MINTiP13051
STRINGi9606.ENSP00000242576

Chemistry databases

BindingDBiP13051
ChEMBLiCHEMBL3277
DrugBankiDB07116 1-(2-DEOXY-5-O-PHOSPHONO-BETA-D-ERYTHRO-PENTOFURANOSYL)-4-METHYL-1H-INDOLE

PTM databases

iPTMnetiP13051
PhosphoSitePlusiP13051

Polymorphism and mutation databases

BioMutaiUNG
DMDMi37999897

Proteomic databases

EPDiP13051
jPOSTiP13051
MaxQBiP13051
PaxDbiP13051
PeptideAtlasiP13051
PRIDEiP13051
ProteomicsDBi52891
52892 [P13051-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
7374
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000242576; ENSP00000242576; ENSG00000076248 [P13051-1]
ENST00000336865; ENSP00000337398; ENSG00000076248 [P13051-2]
GeneIDi7374
KEGGihsa:7374
UCSCiuc001tnz.3 human [P13051-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7374
DisGeNETi7374
EuPathDBiHostDB:ENSG00000076248.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UNG
HGNCiHGNC:12572 UNG
HPAiCAB011605
MalaCardsiUNG
MIMi191525 gene
608106 phenotype
neXtProtiNX_P13051
OpenTargetsiENSG00000076248
Orphaneti101092 Hyper-IgM syndrome type 5
PharmGKBiPA364

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2994 Eukaryota
COG0692 LUCA
GeneTreeiENSGT00390000003405
HOGENOMiHOG000229528
HOVERGENiHBG000396
InParanoidiP13051
KOiK03648
OMAiDNGYLMP
OrthoDBi1132313at2759
PhylomeDBiP13051
TreeFamiTF315028

Enzyme and pathway databases

BRENDAi3.2.2.27 2681
ReactomeiR-HSA-110328 Recognition and association of DNA glycosylase with site containing an affected pyrimidine
R-HSA-110329 Cleavage of the damaged pyrimidine
R-HSA-110357 Displacement of DNA glycosylase by APEX1
SABIO-RKiP13051

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
UNG human
EvolutionaryTraceiP13051

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Uracil-DNA_glycosylase

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7374

Protein Ontology

More...
PROi
PR:P13051

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000076248 Expressed in 229 organ(s), highest expression level in secondary oocyte
ExpressionAtlasiP13051 baseline and differential
GenevisibleiP13051 HS

Family and domain databases

CDDicd10027 UDG_F1, 1 hit
Gene3Di3.40.470.10, 1 hit
HAMAPiMF_00148 UDG, 1 hit
InterProiView protein in InterPro
IPR002043 UDG_fam1
IPR018085 Ura-DNA_Glyclase_AS
IPR005122 Uracil-DNA_glycosylase-like
IPR036895 Uracil-DNA_glycosylase-like_sf
PANTHERiPTHR11264 PTHR11264, 1 hit
PfamiView protein in Pfam
PF03167 UDG, 1 hit
SMARTiView protein in SMART
SM00986 UDG, 1 hit
SUPFAMiSSF52141 SSF52141, 1 hit
TIGRFAMsiTIGR00628 ung, 1 hit
PROSITEiView protein in PROSITE
PS00130 U_DNA_GLYCOSYLASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUNG_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P13051
Secondary accession number(s): A8K5M6
, B2R8Y1, O00637, O00719, Q93028
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: October 10, 2003
Last modified: February 13, 2019
This is version 207 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again