UniProtKB - P12732 (RL23_HALMA)

BLAST

>sp|P12732|RL23_HALMA 50S ribosomal protein L23 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) OX=272569 GN=rpl23 PE=1 SV=2
MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMD
GEKKAVVRLSEDDDAQEVASRIGVF

Align
Format
Add to basket Added to basket
History
Entry version 138 (10 Oct 2018)
Sequence version 2 (23 Jan 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

50S ribosomal protein L23

Gene

rpl23

Organism

Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Binds to a specific region on the 23S rRNA. Located at the polypeptide exit tunnel on the outside of the subunit.

GO - Molecular functionⁱ

rRNA binding Source: UniProtKB-UniRule
structural constituent of ribosome Source: InterPro

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

translation Source: UniProtKB-UniRule

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Molecular function

Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: 50S ribosomal protein L23UniRule annotation Alternative name(s): Hl25 Hmal23 L21
Gene namesⁱ	Name:rpl23UniRule annotation Ordered Locus Names:rrnAC1609
Organismⁱ	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)
Taxonomic identifierⁱ	272569 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Archaea › Euryarchaeota › Stenosarchaea group › Halobacteria › Halobacteriales › Haloarculaceae › Haloarcula › Haloarcula marismortui
Proteomesⁱ	UP000001169 Componentⁱ: Chromosome I

Subcellular locationⁱ

GO - Cellular componentⁱ

ribosome Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		Removed2 Publications
ChainⁱPRO_0000129435	2 – 85	50S ribosomal protein L23Add BLAST		84

Interactionⁱ

Subunit structureⁱ

Part of the 50S ribosomal subunit. Interacts with protein L29 and weakly with protein L39e.UniRule annotation2 Publications

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1609

STRINGⁱ

272569.rrnAC1609

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	5 – 9	Combined sources	5
Helixⁱ	13 – 21	Combined sources	9
Beta strandⁱ	24 – 29	Combined sources	6
Helixⁱ	35 – 46	Combined sources	12
Beta strandⁱ	50 – 57	Combined sources	8
Beta strandⁱ	61 – 69	Combined sources	9
Beta strandⁱ	71 – 73	Combined sources	3
Helixⁱ	75 – 79	Combined sources	5

Show more details

3D structure databases

ProteinModelPortalⁱ	P12732
SMRⁱ	P12732
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P12732

EvolutionaryTraceⁱ

P12732

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the universal ribosomal protein uL23 family.UniRule annotation

Phylogenomic databases

eggNOGⁱ	arCOG04072 Archaea COG0089 LUCA
HOGENOMⁱ	HOG000231364
KEGG Orthology (KO) More...KOⁱ	K02892
OMAⁱ	MDPYKVI
Database of Orthologous Groups More...OrthoDBⁱ	POG093Z0KQ0

Family and domain databases

Gene3Dⁱ	3.30.70.330, 1 hit
HAMAPⁱ	MF_01369_A Ribosomal_L23_A, 1 hit
InterProⁱ	View protein in InterPro IPR012677 Nucleotide-bd_a/b_plait_sf IPR019985 Ribosomal_L23 IPR012678 Ribosomal_L23/L15e_core_dom_sf IPR001014 Ribosomal_L23/L25_CS IPR013025 Ribosomal_L25/23
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00276 Ribosomal_L23, 1 hit
SUPFAMⁱ	SSF54189 SSF54189, 1 hit
TIGRFAMsⁱ	TIGR03636 uL23_arch, 1 hit
PROSITEⁱ	View protein in PROSITE PS00050 RIBOSOMAL_L23, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P12732-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MSWDVIKHPH VTEKAMNDMD FQNKLQFAVD DRASKGEVAD AVEEQYDVTV 
        60         70         80 
EQVNTQNTMD GEKKAVVRLS EDDDAQEVAS RIGVF

Length:85

Mass (Da):9,602

Last modified:January 23, 2007 - v2

Checksum:ⁱ2A2E869D640D5B60

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	J05222 Genomic DNA Translation: AAA86861.1 AY596297 Genomic DNA Translation: AAV46526.1
PIRⁱ	E35063 R5HS23
NCBI Reference Sequences More...RefSeqⁱ	WP_004591553.1, NC_006396.1

Genome annotation databases

EnsemblBacteriaⁱ	AAV46526; AAV46526; rrnAC1609
GeneIDⁱ	35220742
KEGGⁱ	hma:rrnAC1609
PATRICⁱ	fig\|272569.17.peg.2299

Protein	Similar proteins		Species	Score	Length	Source
P12732	50S ribosomal protein L23		Haloarcula amylolytica JCM 13557		85	UniRef100_P12732
50S ribosomal protein L23		HALHT		85
50S ribosomal protein L23		Haloarcula hispanica N601		85
50S ribosomal protein L23		Haloarcula taiwanensis		85
50S ribosomal protein L23		Haloarcula sp. K1		85
+7

Protein	Similar proteins		Species	Score	Length	Source
P12732	50S ribosomal protein L23		Haloarcula amylolytica JCM 13557		85	UniRef90_P12732
50S ribosomal protein L23		HALHT		85
50S ribosomal protein L23		Haloarcula hispanica N601		85
50S ribosomal protein L23		Haloarcula taiwanensis		85
50S ribosomal protein L23		Haloarcula sp. K1		85
+11

Protein	Similar proteins		Species	Score	Length	Source
P12732	50S ribosomal protein L23		HALSA		84	UniRef50_P12732
50S ribosomal protein L23		HALWD		84
50S ribosomal protein L23		NATPD		82
50S ribosomal protein L23		Haloarcula amylolytica JCM 13557		85
50S ribosomal protein L23		HALHT		85
+292

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	J05222 Genomic DNA Translation: AAA86861.1 AY596297 Genomic DNA Translation: AAV46526.1
PIRⁱ	E35063 R5HS23
RefSeqⁱ	WP_004591553.1, NC_006396.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1FFK	X-ray	2.40	P	2-85	[»]
	1JJ2	X-ray	2.40	R	2-85	[»]
	1K73	X-ray	3.01	T	2-85	[»]
	1K8A	X-ray	3.00	T	2-85	[»]
	1K9M	X-ray	3.00	T	2-85	[»]
	1KC8	X-ray	3.01	T	2-85	[»]
	1KD1	X-ray	3.00	T	2-85	[»]
	1KQS	X-ray	3.10	R	2-85	[»]
	1M1K	X-ray	3.20	T	2-85	[»]
	1M90	X-ray	2.80	T	2-85	[»]
	1N8R	X-ray	3.00	T	2-85	[»]
	1NJI	X-ray	3.00	T	2-85	[»]
	1Q7Y	X-ray	3.20	T	2-85	[»]
	1Q81	X-ray	2.95	T	2-85	[»]
	1Q82	X-ray	2.98	T	2-85	[»]
	1Q86	X-ray	3.00	T	2-85	[»]
	1QVF	X-ray	3.10	R	2-85	[»]
	1QVG	X-ray	2.90	R	2-85	[»]
	1S72	X-ray	2.40	S	1-85	[»]
	1VQ4	X-ray	2.70	S	1-85	[»]
	1VQ5	X-ray	2.60	S	1-85	[»]
	1VQ6	X-ray	2.70	S	1-85	[»]
	1VQ7	X-ray	2.50	S	1-85	[»]
	1VQ8	X-ray	2.20	S	1-85	[»]
	1VQ9	X-ray	2.40	S	1-85	[»]
	1VQK	X-ray	2.30	S	1-85	[»]
	1VQL	X-ray	2.30	S	1-85	[»]
	1VQM	X-ray	2.30	S	1-85	[»]
	1VQN	X-ray	2.40	S	1-85	[»]
	1VQO	X-ray	2.20	S	1-85	[»]
	1VQP	X-ray	2.25	S	1-85	[»]
	1W2B	X-ray	3.50	R	2-85	[»]
	1YHQ	X-ray	2.40	S	1-85	[»]
	1YI2	X-ray	2.65	S	1-85	[»]
	1YIJ	X-ray	2.60	S	1-85	[»]
	1YIT	X-ray	2.80	S	1-85	[»]
	1YJ9	X-ray	2.90	S	1-85	[»]
	1YJN	X-ray	3.00	S	1-85	[»]
	1YJW	X-ray	2.90	S	1-85	[»]
	2OTJ	X-ray	2.90	S	1-85	[»]
	2OTL	X-ray	2.70	S	1-85	[»]
	2QA4	X-ray	3.00	S	1-85	[»]
	2QEX	X-ray	2.90	S	1-85	[»]
	3CC2	X-ray	2.40	S	1-85	[»]
	3CC4	X-ray	2.70	S	1-85	[»]
	3CC7	X-ray	2.70	S	1-85	[»]
	3CCE	X-ray	2.75	S	1-85	[»]
	3CCJ	X-ray	2.70	S	1-85	[»]
	3CCL	X-ray	2.90	S	1-85	[»]
	3CCM	X-ray	2.55	S	1-85	[»]
	3CCQ	X-ray	2.90	S	1-85	[»]
	3CCR	X-ray	3.00	S	1-85	[»]
	3CCS	X-ray	2.95	S	1-85	[»]
	3CCU	X-ray	2.80	S	1-85	[»]
	3CCV	X-ray	2.90	S	1-85	[»]
	3CD6	X-ray	2.75	S	1-85	[»]
	3CMA	X-ray	2.80	S	1-85	[»]
	3CME	X-ray	2.95	S	1-85	[»]
	3CPW	X-ray	2.70	R	1-85	[»]
	3CXC	X-ray	3.00	R	2-85	[»]
	3G4S	X-ray	3.20	S	2-82	[»]
	3G6E	X-ray	2.70	S	2-82	[»]
	3G71	X-ray	2.85	S	2-82	[»]
3I55	X-ray	3.11	S	1-85	[»]
3I56	X-ray	2.90	S	1-85	[»]
3OW2	X-ray	2.70	R	2-82	[»]
4ADX	electron microscopy	6.60	S	1-85	[»]
4V4S	X-ray	6.76	X	2-85	[»]
4V4T	X-ray	6.46	X	2-85	[»]
4V9F	X-ray	2.40	S	1-85	[»]
ProteinModelPortalⁱ	P12732
SMRⁱ	P12732
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1609

STRINGⁱ

272569.rrnAC1609

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAV46526; AAV46526; rrnAC1609
GeneIDⁱ	35220742
KEGGⁱ	hma:rrnAC1609
PATRICⁱ	fig\|272569.17.peg.2299

Phylogenomic databases

eggNOGⁱ	arCOG04072 Archaea COG0089 LUCA
HOGENOMⁱ	HOG000231364
KOⁱ	K02892
OMAⁱ	MDPYKVI
OrthoDBⁱ	POG093Z0KQ0

Miscellaneous databases

EvolutionaryTraceⁱ	P12732

EvolutionaryTraceⁱ

P12732

Family and domain databases

Gene3Dⁱ	3.30.70.330, 1 hit
HAMAPⁱ	MF_01369_A Ribosomal_L23_A, 1 hit
InterProⁱ	View protein in InterPro IPR012677 Nucleotide-bd_a/b_plait_sf IPR019985 Ribosomal_L23 IPR012678 Ribosomal_L23/L15e_core_dom_sf IPR001014 Ribosomal_L23/L25_CS IPR013025 Ribosomal_L25/23
Pfamⁱ	View protein in Pfam PF00276 Ribosomal_L23, 1 hit
SUPFAMⁱ	SSF54189 SSF54189, 1 hit
TIGRFAMsⁱ	TIGR03636 uL23_arch, 1 hit
PROSITEⁱ	View protein in PROSITE PS00050 RIBOSOMAL_L23, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RL23_HALMA
Accessionⁱ	P12732Primary (citable) accession number: P12732 Secondary accession number(s): Q5V1S6
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	October 1, 1989
	Last sequence update:	January 23, 2007
	Last modified:	October 10, 2018
	This is version 138 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P12732 (RL23_HALMA)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

50S ribosomal protein L23

rpl23

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protocols and materials databases

Genome annotation databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ