Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein L-Myc

Gene

MYCL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein L-Myc
Alternative name(s):
Class E basic helix-loop-helix protein 38
Short name:
bHLHe38
Protein L-Myc-1
V-myc myelocytomatosis viral oncogene homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MYCL
Synonyms:BHLHE38, LMYC, MYCL1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000116990.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7555 MYCL

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
164850 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P12524

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
4610

Open Targets

More...
OpenTargetsi
ENSG00000116990

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31355

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MYCL

Domain mapping of disease mutations (DMDM)

More...
DMDMi
311033401

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001273331 – 364Protein L-MycAdd BLAST364

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P12524

PeptideAtlas

More...
PeptideAtlasi
P12524

PRoteomics IDEntifications database

More...
PRIDEi
P12524

ProteomicsDB human proteome resource

More...
ProteomicsDBi
52853
52854 [P12524-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P12524

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P12524

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000116990 Expressed in 147 organ(s), highest expression level in body of pancreas

CleanEx database of gene expression profiles

More...
CleanExi
HS_MYCL1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P12524 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P12524 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA063132

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX.

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110695, 41 interactors

Protein interaction database and analysis system

More...
IntActi
P12524, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000380494

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P12524

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P12524

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini281 – 333bHLHPROSITE-ProRule annotationAdd BLAST53

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni333 – 361Leucine-zipperAdd BLAST29

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFII Eukaryota
ENOG410Y7JV LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158613

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000043075

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000472

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P12524

KEGG Orthology (KO)

More...
KOi
K09110

Identification of Orthologs from Complete Genome Data

More...
OMAi
AWGRNYA

Database of Orthologous Groups

More...
OrthoDBi
1821999at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P12524

TreeFam database of animal gene trees

More...
TreeFami
TF106001

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00083 HLH, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
4.10.280.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011598 bHLH_dom
IPR036638 HLH_DNA-bd_sf
IPR002418 Tscrpt_reg_Myc
IPR012682 Tscrpt_reg_Myc_N

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00010 HLH, 1 hit
PF01056 Myc_N, 2 hits

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001705 Myc_protein, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00044 LEUZIPPRMYC

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00353 HLH, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47459 SSF47459, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50888 BHLH, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P12524-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDYDSYQHYF YDYDCGEDFY RSTAPSEDIW KKFELVPSPP TSPPWGLGPG
60 70 80 90 100
AGDPAPGIGP PEPWPGGCTG DEAESRGHSK GWGRNYASII RRDCMWSGFS
110 120 130 140 150
ARERLERAVS DRLAPGAPRG NPPKASAAPD CTPSLEAGNP APAAPCPLGE
160 170 180 190 200
PKTQACSGSE SPSDSENEEI DVVTVEKRQS LGIRKPVTIT VRADPLDPCM
210 220 230 240 250
KHFHISIHQQ QHNYAARFPP ESCSQEEASE RGPQEEVLER DAAGEKEDEE
260 270 280 290 300
DEEIVSPPPV ESEAAQSCHP KPVSSDTEDV TKRKNHNFLE RKRRNDLRSR
310 320 330 340 350
FLALRDQVPT LASCSKAPKV VILSKALEYL QALVGAEKRM ATEKRQLRCR
360
QQQLQKRIAY LTGY
Length:364
Mass (Da):40,327
Last modified:November 2, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i58F8A30A1C2ED6D4
GO
Isoform 2 (identifier: P12524-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCVCAGCRAAPSRRGAGPLQVAGGWSEGADM
     166-206: ENEEIDVVTV...DPCMKHFHIS → GKDLPEPSKR...ALGPSPPLFG
     207-364: Missing.

Show »
Length:236
Mass (Da):24,682
Checksum:i5059EED93CE18391
GO
Isoform 3 (identifier: P12524-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCVCAGCRAAPSRRGAGPLQVAGGWSEGADM

Show »
Length:394
Mass (Da):43,243
Checksum:i518156A7EC80C6E2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PQS5E9PQS5_HUMAN
Protein L-Myc
MYCL
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH11864 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAA30248 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_027802362T → S4 PublicationsCorresponds to variant dbSNP:rs3134614Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0537661M → MCVCAGCRAAPSRRGAGPLQ VAGGWSEGADM in isoform 2 and isoform 3. 2 Publications1
Alternative sequenceiVSP_015539166 – 206ENEEI…HFHIS → GKDLPEPSKRGPPHGWPKLC PCLRSGIGSSQALGPSPPLF G in isoform 2. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_015540207 – 364Missing in isoform 2. 1 PublicationAdd BLAST158

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X07262 Genomic DNA Translation: CAA30248.1 Sequence problems.
X07263 Genomic DNA Translation: CAA30249.1
M19720 Genomic DNA Translation: AAA59879.1
M19720 Genomic DNA Translation: AAA59878.1
AK296078 mRNA Translation: BAG58834.1
AL033527 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07251.1
BC011864 mRNA Translation: AAH11864.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30682.1 [P12524-1]
CCDS44117.2 [P12524-2]
CCDS53300.1 [P12524-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
A27675 TVHUML

NCBI Reference Sequences

More...
RefSeqi
NP_001028253.1, NM_001033081.2 [P12524-1]
NP_001028254.2, NM_001033082.2 [P12524-3]
NP_005367.2, NM_005376.4 [P12524-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.437922

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000372815; ENSP00000361902; ENSG00000116990 [P12524-2]
ENST00000372816; ENSP00000361903; ENSG00000116990 [P12524-1]
ENST00000397332; ENSP00000380494; ENSG00000116990 [P12524-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4610

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4610

UCSC genome browser

More...
UCSCi
uc001cer.3 human [P12524-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X07262 Genomic DNA Translation: CAA30248.1 Sequence problems.
X07263 Genomic DNA Translation: CAA30249.1
M19720 Genomic DNA Translation: AAA59879.1
M19720 Genomic DNA Translation: AAA59878.1
AK296078 mRNA Translation: BAG58834.1
AL033527 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07251.1
BC011864 mRNA Translation: AAH11864.1 Different initiation.
CCDSiCCDS30682.1 [P12524-1]
CCDS44117.2 [P12524-2]
CCDS53300.1 [P12524-3]
PIRiA27675 TVHUML
RefSeqiNP_001028253.1, NM_001033081.2 [P12524-1]
NP_001028254.2, NM_001033082.2 [P12524-3]
NP_005367.2, NM_005376.4 [P12524-2]
UniGeneiHs.437922

3D structure databases

ProteinModelPortaliP12524
SMRiP12524
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110695, 41 interactors
IntActiP12524, 6 interactors
STRINGi9606.ENSP00000380494

PTM databases

iPTMnetiP12524
PhosphoSitePlusiP12524

Polymorphism and mutation databases

BioMutaiMYCL
DMDMi311033401

Proteomic databases

PaxDbiP12524
PeptideAtlasiP12524
PRIDEiP12524
ProteomicsDBi52853
52854 [P12524-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4610
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372815; ENSP00000361902; ENSG00000116990 [P12524-2]
ENST00000372816; ENSP00000361903; ENSG00000116990 [P12524-1]
ENST00000397332; ENSP00000380494; ENSG00000116990 [P12524-3]
GeneIDi4610
KEGGihsa:4610
UCSCiuc001cer.3 human [P12524-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4610
DisGeNETi4610
EuPathDBiHostDB:ENSG00000116990.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MYCL
HGNCiHGNC:7555 MYCL
HPAiHPA063132
MIMi164850 gene
neXtProtiNX_P12524
OpenTargetsiENSG00000116990
PharmGKBiPA31355

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IFII Eukaryota
ENOG410Y7JV LUCA
GeneTreeiENSGT00940000158613
HOGENOMiHOG000043075
HOVERGENiHBG000472
InParanoidiP12524
KOiK09110
OMAiAWGRNYA
OrthoDBi1821999at2759
PhylomeDBiP12524
TreeFamiTF106001

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MYCL human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MYCL1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4610

Protein Ontology

More...
PROi
PR:P12524

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000116990 Expressed in 147 organ(s), highest expression level in body of pancreas
CleanExiHS_MYCL1
ExpressionAtlasiP12524 baseline and differential
GenevisibleiP12524 HS

Family and domain databases

CDDicd00083 HLH, 1 hit
Gene3Di4.10.280.10, 1 hit
InterProiView protein in InterPro
IPR011598 bHLH_dom
IPR036638 HLH_DNA-bd_sf
IPR002418 Tscrpt_reg_Myc
IPR012682 Tscrpt_reg_Myc_N
PfamiView protein in Pfam
PF00010 HLH, 1 hit
PF01056 Myc_N, 2 hits
PIRSFiPIRSF001705 Myc_protein, 1 hit
PRINTSiPR00044 LEUZIPPRMYC
SMARTiView protein in SMART
SM00353 HLH, 1 hit
SUPFAMiSSF47459 SSF47459, 1 hit
PROSITEiView protein in PROSITE
PS50888 BHLH, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMYCL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P12524
Secondary accession number(s): A2A2C9
, B4DJH2, Q14897, Q5QPL0, Q5QPL1, Q9NUE9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: November 2, 2010
Last modified: January 16, 2019
This is version 175 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again