UniProtKB - P12281 (MOEA_ECOLI)

BLAST

>sp|P12281|MOEA_ECOLI Molybdopterin molybdenumtransferase OS=Escherichia coli (strain K12) OX=83333 GN=moeA PE=1 SV=1
MEFTTGLMSLDTALNEMLSRVTPLTAQETLPLVQCFGRILASDVVSPLDVPGFDNSAMDG
YAVRLADIASGQPLPVAGKSFAGQPYHGEWPAGTCIRIMTGAPVPEGCEAVVMQEQTEQM
DNGVRFTAEVRSGQNIRRRGEDISAGAVVFPAGTRLTTAELPVIASLGIAEVPVIRKVRV
ALFSTGDELQLPGQPLGDGQIYDTNRLAVHLMLEQLGCEVINLGIIRDDPHALRAAFIEA
DSQADVVISSGGVSVGEADYTKTILEELGEIAFWKLAIKPGKPFAFGKLSNSWFCGLPGN
PVSATLTFYQLVQPLLAKLSGNTASGLPARQRVRTASRLKKTPGRLDFQRGVLQRNADGE
LEVTTTGHQGSHIFSSFSLGNCFIVLERDRGNVEVGEWVEVEPFNALFGGL

Align
Format
Add to basket Added to basket
History
Entry version 164 (07 Nov 2018)
Sequence version 1 (01 Oct 1989)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Molybdopterin molybdenumtransferase

Gene

moeA

Organism

Escherichia coli (strain K12)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Catalyzes the insertion of molybdate into adenylated molybdopterin with the concomitant release of AMP.1 Publication

Catalytic activityⁱ

Adenylyl-molybdopterin + molybdate = molybdenum cofactor + AMP.

Cofactorⁱ

Mg²⁺1 PublicationNote: Binds 1 Mg²⁺ ion per subunit.1 Publication

Pathwayⁱ: molybdopterin biosynthesis

This protein is involved in the pathway molybdopterin biosynthesis, which is part of Cofactor biosynthesis.
View all proteins of this organism that are known to be involved in the pathway molybdopterin biosynthesis and in Cofactor biosynthesis.

GO - Molecular functionⁱ

identical protein binding
Source: IntAct
Inferred from physical interactionⁱ
metal ion binding Source: UniProtKB-KW
molybdopterin adenylyltransferase activity
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
molybdopterin molybdotransferase activity
Source: EcoCyc
Inferred from direct assayⁱ
- 15632135

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

molybdenum incorporation into molybdenum-molybdopterin complex
Source: EcoCyc
Inferred from direct assayⁱ
- 12006571
molybdopterin cofactor biosynthetic process
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
Mo-molybdopterin cofactor biosynthetic process
Source: EcoCyc
Inferred from direct assayⁱ
- 12006571

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Transferase
Biological process	Molybdenum cofactor biosynthesis
Ligand	Magnesium, Metal-binding, Molybdenum

Enzyme and pathway databases

BioCycⁱ	EcoCyc:EG10153-MONOMER MetaCyc:EG10153-MONOMER
BRENDAⁱ	2.10.1.1 2026
UniPathwayⁱ	UPA00344

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Molybdopterin molybdenumtransferase (EC:2.10.1.1) Short name: MPT Mo-transferase
Gene namesⁱ	Name:moeA Synonyms:bisB, chlE, narE Ordered Locus Names:b0827, JW0811
Organismⁱ	Escherichia coli (strain K12)
Taxonomic identifierⁱ	83333 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Bacteria › Proteobacteria › Gammaproteobacteria › Enterobacterales › Enterobacteriaceae › Escherichia › Escherichia coli
Proteomesⁱ	UP000000318 Componentⁱ: Chromosome UP000000625 Componentⁱ: Chromosome

Organism-specific databases

EcoGeneⁱ	EG10153 moeA

EcoGeneⁱ

EG10153 moeA

Subcellular locationⁱ

GO - Cellular componentⁱ

cytoplasm
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
cytosol
Source: EcoCyc
Inferred from direct assayⁱ
- 11934270
- 18304323

View the complete GO annotation on QuickGO ...

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000170989	1 – 411	Molybdopterin molybdenumtransferaseAdd BLAST		411

Proteomic databases

EPDⁱ	P12281
PaxDbⁱ	P12281
PRIDEⁱ	P12281

Interactionⁱ

Subunit structureⁱ

Homodimer. Interacts with MobA, MogA and MobB in vivo.3 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
itself		5	EBI-554393,EBI-554393
mobA	P32173	3	EBI-554393,EBI-1133881
pfkA	P0A796	2	EBI-554393,EBI-554405

GO - Molecular functionⁱ

identical protein binding
Source: IntAct
Inferred from physical interactionⁱ

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	4259979, 41 interactors
Database of interacting proteins More...DIPⁱ	DIP-10240N
IntActⁱ	P12281, 8 interactors
STRINGⁱ	316385.ECDH10B_0896

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	10 – 20	Combined sources	11
Beta strandⁱ	27 – 31	Combined sources	5
Helixⁱ	32 – 34	Combined sources	3
Beta strandⁱ	39 – 42	Combined sources	4
Beta strandⁱ	50 – 53	Combined sources	4
Beta strandⁱ	55 – 63	Combined sources	9
Helixⁱ	65 – 70	Combined sources	6
Beta strandⁱ	76 – 81	Combined sources	6
Beta strandⁱ	82 – 84	Combined sources	3
Beta strandⁱ	95 – 98	Combined sources	4
Beta strandⁱ	110 – 113	Combined sources	4
Helixⁱ	114 – 116	Combined sources	3
Beta strandⁱ	117 – 120	Combined sources	4
Beta strandⁱ	123 – 126	Combined sources	4
Turnⁱ	132 – 135	Combined sources	4
Beta strandⁱ	141 – 143	Combined sources	3
Beta strandⁱ	147 – 150	Combined sources	4
Turnⁱ	158 – 160	Combined sources	3
Helixⁱ	161 – 166	Combined sources	6
Beta strandⁱ	171 – 175	Combined sources	5
Beta strandⁱ	179 – 185	Combined sources	7
Beta strandⁱ	187 – 190	Combined sources	4
Beta strandⁱ	192 – 194	Combined sources	3
Helixⁱ	205 – 215	Combined sources	11
Beta strandⁱ	219 – 226	Combined sources	8
Helixⁱ	230 – 243	Combined sources	14
Beta strandⁱ	245 – 249	Combined sources	5
Beta strandⁱ	251 – 253	Combined sources	3
Beta strandⁱ	255 – 257	Combined sources	3
Helixⁱ	260 – 268	Combined sources	9
Beta strandⁱ	269 – 280	Combined sources	12
Beta strandⁱ	283 – 288	Combined sources	6
Beta strandⁱ	290 – 296	Combined sources	7
Helixⁱ	301 – 310	Combined sources	10
Helixⁱ	312 – 320	Combined sources	9
Beta strandⁱ	326 – 328	Combined sources	3
Beta strandⁱ	331 – 337	Combined sources	7
Beta strandⁱ	345 – 355	Combined sources	11
Beta strandⁱ	357 – 359	Combined sources	3
Beta strandⁱ	361 – 365	Combined sources	5
Helixⁱ	376 – 379	Combined sources	4
Beta strandⁱ	381 – 386	Combined sources	6
Beta strandⁱ	398 – 403	Combined sources	6
Helixⁱ	406 – 408	Combined sources	3

Show more details

3D structure databases

ProteinModelPortalⁱ	P12281
SMRⁱ	P12281
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ

P12281

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the MoeA family.Curated

Phylogenomic databases

eggNOGⁱ	ENOG4105CVM Bacteria COG0303 LUCA
HOGENOMⁱ	HOG000280652
InParanoidⁱ	P12281
KEGG Orthology (KO) More...KOⁱ	K03750
PhylomeDBⁱ	P12281

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00887 MoeA, 1 hit
Gene3Dⁱ	2.40.340.10, 1 hit 3.40.980.10, 1 hit
InterProⁱ	View protein in InterPro IPR036425 MoaB/Mog-like_dom_sf IPR001453 MoaB/Mog_dom IPR008284 MoCF_biosynth_CS IPR038987 MoeA-like IPR005111 MoeA_C_domain_IV IPR036688 MoeA_C_domain_IV_sf IPR005110 MoeA_linker/N IPR036135 MoeA_linker/N_sf
PANTHERⁱ	PTHR10192 PTHR10192, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00994 MoCF_biosynth, 1 hit PF03454 MoeA_C, 1 hit PF03453 MoeA_N, 1 hit
SMARTⁱ	View protein in SMART SM00852 MoCF_biosynth, 1 hit
SUPFAMⁱ	SSF53218 SSF53218, 1 hit SSF63867 SSF63867, 1 hit SSF63882 SSF63882, 1 hit
TIGRFAMsⁱ	TIGR00177 molyb_syn, 1 hit
PROSITEⁱ	View protein in PROSITE PS01079 MOCF_BIOSYNTHESIS_2, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

P12281-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MEFTTGLMSL DTALNEMLSR VTPLTAQETL PLVQCFGRIL ASDVVSPLDV 
        60         70         80         90        100
PGFDNSAMDG YAVRLADIAS GQPLPVAGKS FAGQPYHGEW PAGTCIRIMT 
       110        120        130        140        150
GAPVPEGCEA VVMQEQTEQM DNGVRFTAEV RSGQNIRRRG EDISAGAVVF 
       160        170        180        190        200
PAGTRLTTAE LPVIASLGIA EVPVIRKVRV ALFSTGDELQ LPGQPLGDGQ 
       210        220        230        240        250
IYDTNRLAVH LMLEQLGCEV INLGIIRDDP HALRAAFIEA DSQADVVISS 
       260        270        280        290        300
GGVSVGEADY TKTILEELGE IAFWKLAIKP GKPFAFGKLS NSWFCGLPGN 
       310        320        330        340        350
PVSATLTFYQ LVQPLLAKLS GNTASGLPAR QRVRTASRLK KTPGRLDFQR 
       360        370        380        390        400
GVLQRNADGE LEVTTTGHQG SHIFSSFSLG NCFIVLERDR GNVEVGEWVE 
       410 
VEPFNALFGG L

Length:411

Mass (Da):44,067

Last modified:October 1, 1989 - v1

Checksum:ⁱ6DBBC2B4191F5951

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M21151 Genomic DNA Translation: AAA23579.1 U00096 Genomic DNA Translation: AAC73914.1 AP009048 Genomic DNA Translation: BAA35515.1
PIRⁱ	A32352
NCBI Reference Sequences More...RefSeqⁱ	NP_415348.1, NC_000913.3 WP_000397340.1, NZ_LN832404.1

Genome annotation databases

EnsemblBacteriaⁱ	AAC73914; AAC73914; b0827 BAA35515; BAA35515; BAA35515
GeneIDⁱ	945454
KEGGⁱ	ecj:JW0811 eco:b0827
PATRICⁱ	fig\|1411691.4.peg.1451

Protein	Similar proteins		Species	Score	Length	Source
P12281	Molybdopterin molybdenumtransferase		Shigella sp.		411	UniRef100_P12281
Molybdenum cofactor synthesis domain protein		ECOLX		411
Molybdopterin molybdenumtransferase		SHIBO		411
Molybdopterin molybdenumtransferase		Escherichia coli 1-110-08_S3_C1		411
Molybdopterin molybdenumtransferase		Escherichia coli DEC6A		411
+11

Protein	Similar proteins		Species	Score	Length	Source
P12281	Molybdopterin molybdenumtransferase		Shigella sp.		411	UniRef90_P12281
Molybdenum cofactor synthesis domain protein		ECOLX		411
Molybdopterin molybdenumtransferase		SHIBO		411
Molybdopterin molybdenumtransferase		Escherichia coli 1-110-08_S3_C1		411
Molybdopterin molybdenumtransferase		Escherichia coli DEC6A		411
+868

Protein	Similar proteins		Species	Score	Length	Source
P12281	Molybdopterin molybdenumtransferase		Shigella sp.		411	UniRef50_P12281
Molybdenum cofactor synthesis domain protein		ECOLX		411
Molybdopterin molybdenumtransferase		SHIBO		411
Molybdopterin molybdenumtransferase		Escherichia coli 1-110-08_S3_C1		411
Molybdopterin molybdenumtransferase		Escherichia coli DEC6A		411
+1053

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M21151 Genomic DNA Translation: AAA23579.1 U00096 Genomic DNA Translation: AAC73914.1 AP009048 Genomic DNA Translation: BAA35515.1
PIRⁱ	A32352
RefSeqⁱ	NP_415348.1, NC_000913.3 WP_000397340.1, NZ_LN832404.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1FC5	X-ray	2.20	A/B	1-411	[»]
	1G8L	X-ray	1.95	A/B	1-411	[»]
	1G8R	X-ray	2.65	A/B	1-411	[»]
	2NQK	X-ray	2.90	A/B	1-411	[»]
	2NQM	X-ray	3.00	A/B	1-411	[»]
	2NQN	X-ray	2.20	A/B	1-411	[»]
	2NQQ	X-ray	2.40	A/B/C/D	1-411	[»]
	2NQR	X-ray	2.20	A/B	1-411	[»]
	2NQS	X-ray	2.50	A/B	1-411	[»]
	2NQU	X-ray	2.70	A/B	1-411	[»]
	2NQV	X-ray	2.82	A/B	1-411	[»]
	2NRO	X-ray	2.50	A/B	1-411	[»]
	2NRP	X-ray	3.00	A/B	1-411	[»]
	2NRS	X-ray	2.80	A/B	1-411	[»]
ProteinModelPortalⁱ	P12281
SMRⁱ	P12281
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	4259979, 41 interactors
DIPⁱ	DIP-10240N
IntActⁱ	P12281, 8 interactors
STRINGⁱ	316385.ECDH10B_0896

Proteomic databases

EPDⁱ	P12281
PaxDbⁱ	P12281
PRIDEⁱ	P12281

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAC73914; AAC73914; b0827 BAA35515; BAA35515; BAA35515
GeneIDⁱ	945454
KEGGⁱ	ecj:JW0811 eco:b0827
PATRICⁱ	fig\|1411691.4.peg.1451

Organism-specific databases

EchoBASEⁱ	EB0151
EcoGeneⁱ	EG10153 moeA

Phylogenomic databases

eggNOGⁱ	ENOG4105CVM Bacteria COG0303 LUCA
HOGENOMⁱ	HOG000280652
InParanoidⁱ	P12281
KOⁱ	K03750
PhylomeDBⁱ	P12281

Enzyme and pathway databases

UniPathwayⁱ	UPA00344
BioCycⁱ	EcoCyc:EG10153-MONOMER MetaCyc:EG10153-MONOMER
BRENDAⁱ	2.10.1.1 2026

Miscellaneous databases

EvolutionaryTraceⁱ	P12281
Protein Ontology More...PROⁱ	PR:P12281

Family and domain databases

CDDⁱ	cd00887 MoeA, 1 hit
Gene3Dⁱ	2.40.340.10, 1 hit 3.40.980.10, 1 hit
InterProⁱ	View protein in InterPro IPR036425 MoaB/Mog-like_dom_sf IPR001453 MoaB/Mog_dom IPR008284 MoCF_biosynth_CS IPR038987 MoeA-like IPR005111 MoeA_C_domain_IV IPR036688 MoeA_C_domain_IV_sf IPR005110 MoeA_linker/N IPR036135 MoeA_linker/N_sf
PANTHERⁱ	PTHR10192 PTHR10192, 1 hit
Pfamⁱ	View protein in Pfam PF00994 MoCF_biosynth, 1 hit PF03454 MoeA_C, 1 hit PF03453 MoeA_N, 1 hit
SMARTⁱ	View protein in SMART SM00852 MoCF_biosynth, 1 hit
SUPFAMⁱ	SSF53218 SSF53218, 1 hit SSF63867 SSF63867, 1 hit SSF63882 SSF63882, 1 hit
TIGRFAMsⁱ	TIGR00177 molyb_syn, 1 hit
PROSITEⁱ	View protein in PROSITE PS01079 MOCF_BIOSYNTHESIS_2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	MOEA_ECOLI
Accessionⁱ	P12281Primary (citable) accession number: P12281
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	October 1, 1989
	Last sequence update:	October 1, 1989
	Last modified:	November 7, 2018
	This is version 164 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
PATHWAY comments
Index of metabolic and biosynthesis pathways
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Escherichia coli
Escherichia coli (strain K12): entries and cross-references to EcoGene

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P12281 (MOEA_ECOLI)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Molybdopterin molybdenumtransferase

moeA

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: molybdopterin biosynthesis

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

Pathwayⁱ: molybdopterin biosynthesis

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

PTM / Processingⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ