Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 177 (26 Feb 2020)
Sequence version 4 (16 Aug 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

cAMP-specific 3',5'-cyclic phosphodiesterase

Gene

dnc

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes (By similarity). Vital for female fertility. Required for learning/memory.By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

a divalent metal cationBy similarityNote: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: 3',5'-cyclic AMP degradation

This protein is involved in step 1 of the subpathway that synthesizes AMP from 3',5'-cyclic AMP.
Proteins known to be involved in this subpathway in this organism are:
  1. cAMP-specific 3',5'-cyclic phosphodiesterase, isoform I (dnc), cAMP-specific 3',5'-cyclic phosphodiesterase (dnc), High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 (Pde8), cAMP-specific 3',5'-cyclic phosphodiesterase, isoforms N/G (dnc), cAMP-specific 3',5'-cyclic phosphodiesterase, isoform F (dnc)
This subpathway is part of the pathway 3',5'-cyclic AMP degradation, which is itself part of Purine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes AMP from 3',5'-cyclic AMP, the pathway 3',5'-cyclic AMP degradation and in Purine metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei732Proton donorBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi736Divalent metal cation 1By similarity1
Metal bindingi772Divalent metal cation 1By similarity1
Metal bindingi773Divalent metal cation 1By similarity1
Metal bindingi773Divalent metal cation 2By similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei773cAMPBy similarity1
Metal bindingi890Divalent metal cation 1By similarity1
Binding sitei890cAMPBy similarity1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei893Binds AMP, but not cAMPBy similarity1
Binding sitei941cAMPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi732 – 736cAMPBy similarity5

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
LigandcAMP, Metal-binding

Enzyme and pathway databases

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00762;UER00747

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
cAMP-specific 3',5'-cyclic phosphodiesterase (EC:3.1.4.53)
Alternative name(s):
Learning/memory process protein
Protein dunce
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:dnc
ORF Names:CG32498
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0000479 dnc

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000233421 – 1070cAMP-specific 3',5'-cyclic phosphodiesteraseAdd BLAST1070

Proteomic databases

PRoteomics IDEntifications database

More...
PRIDEi
P12252

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0000479 Expressed in head and 29 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P12252 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P12252 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
57834, 17 interactors

Protein interaction database and analysis system

More...
IntActi
P12252, 3 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P12252

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini656 – 985PDEasePROSITE-ProRule annotationAdd BLAST330

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi19 – 23Poly-Pro5
Compositional biasi57 – 210Ser-richAdd BLAST154
Compositional biasi85 – 130Gln-richAdd BLAST46
Compositional biasi1020 – 1069Gly-richAdd BLAST50

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155190

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00077 HDc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.1300.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003607 HD/PDEase_dom
IPR040844 PDE4_UCR
IPR023088 PDEase
IPR002073 PDEase_catalytic_dom
IPR036971 PDEase_catalytic_dom_sf
IPR023174 PDEase_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF18100 PDE4_UCR, 1 hit
PF00233 PDEase_I, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00387 PDIESTERASE1

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00126 PDEASE_I_1, 1 hit
PS51845 PDEASE_I_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (12+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 12 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

This entry has 12 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform II (identifier: P12252-1) [UniParc]FASTAAdd to basket
Also known as: I, J

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSQESNGGPA AGGGAAAAPP PPPQYIITTP SEVDPDEVRS MADLELGSPE
60 70 80 90 100
KQVQVQSQKF SSTSSTTKVA THSFSMSSSA GTTGQQSKQD SAQQIQQLQQ
110 120 130 140 150
LQQLQQLQQQ QQQQQSQRII SSSTRSQSLQ SSTIVGEATT ITSGAAQILS
160 170 180 190 200
ASAAASLAQQ LKAQSSTSII TSSEQRTSTS TSSSSSTRYI ASGSSNLAGG
210 220 230 240 250
NSNSASSASS KTRFQSFLQQ PEGAHGFLTA HQKHVRQFVR STSAHSEAAA
260 270 280 290 300
GVAGARAEKC IRSASTQIDD ASVAGVVESA GNLTDSSATG GSMQLSMSKL
310 320 330 340 350
GLQQSSSILI SKSAETIEMK SSSAGMRTQL TLSGGFLAPP GNRKITILSP
360 370 380 390 400
IHAPPGLHDM LKRAQGRSPL SPRISFPGSD SDLFGFDVEN GQGARSPLEG
410 420 430 440 450
GSPSAGLVLQ NLPQRRESFL YRSDSDFEMS PKSMSRNSSI ASERFKEQEA
460 470 480 490 500
SILVDRSHGE DLIVTPFAQI LASLRSVRNN LLSLTNVPAS NKSRRPNQSS
510 520 530 540 550
SASRSGNPPG APLSQGEEAY TRLATDTIEE LDWCLDQLET IQTHRSVSDM
560 570 580 590 600
ASLKFKRMLN KELSHFSESS RSGNQISEYI CSTFLDKQQE FDLPSLRVED
610 620 630 640 650
NPELVAANAA AGQQSAGQYA RSRSPRGPPM SQISGVKRPL SHTNSFTGER
660 670 680 690 700
LPTFGVETPR ENELGTLLGE LDTWGIQIFS IGEFSVNRPL TCVAYTIFQS
710 720 730 740 750
RELLTSLMIP PKTFLNFMST LEDHYVKDNP FHNSLHAADV TQSTNVLLNT
760 770 780 790 800
PALEGVFTPL EVGGALFAAC IHDVDHPGLT NQFLVNSSSE LALMYNDESV
810 820 830 840 850
LENHHLAVAF KLLQNQGCDI FCNMQKKQRQ TLRKMVIDIV LSTDMSKHMS
860 870 880 890 900
LLADLKTMVE TKKVAGSGVL LLDNYTDRIQ VLENLVHCAD LSNPTKPLPL
910 920 930 940 950
YKRWVALLME EFFLQGDKER ESGMDISPMC DRHNATIEKS QVGFIDYIVH
960 970 980 990 1000
PLWETWADLV HPDAQDILDT LEENRDYYQS MIPPSPPPSG VDENPQEDRI
1010 1020 1030 1040 1050
RFQVTLEESD QENLAELEEG DESGGESTTT GTTGTTAASA LSGAGGGGGG
1060 1070
GGGMAPRTGG CQNQPQHGGM
Length:1,070
Mass (Da):115,079
Last modified:August 16, 2005 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i50A63BF7BCC8EDD9
GO
Isoform IV (identifier: P12252-3) [UniParc]FASTAAdd to basket
Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     1-369: Missing.
     370-385: LSPRISFPGSDSDLFG → MVCSFCCCCYNFRNSP

Show »
Length:701
Mass (Da):77,193
Checksum:i52B25B32753A0EFE
GO
Isoform V (identifier: P12252-4) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     444-456: Missing.

Show »
Length:1,057
Mass (Da):113,506
Checksum:iF6A7B73FAB4F196B
GO
Isoform VI (identifier: P12252-5) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     493-494: Missing.

Show »
Length:1,068
Mass (Da):114,836
Checksum:iBA4F5909F5F710C3
GO
Isoform VII (identifier: P12252-6) [UniParc]FASTAAdd to basket
Also known as: L

The sequence of this isoform differs from the canonical sequence as follows:
     1-549: Missing.

Show »
Length:521
Mass (Da):57,358
Checksum:i0F40B7345882579D
GO
Isoform III (identifier: P12252-7) [UniParc]FASTAAdd to basket
Also known as: E, P

The sequence of this isoform differs from the canonical sequence as follows:
     1-428: Missing.

Note: Produced by alternative initiation at Met-429 of isoform II.Curated
Show »
Length:642
Mass (Da):70,625
Checksum:i5F2BA8CE14598DCD
GO
Isoform R (identifier: P12252-8) [UniParc] [UniParc]FASTAAdd to basket
Also known as: Q

The sequence of this isoform differs from the canonical sequence as follows:
     1-367: Missing.
     368-385: SPLSPRISFPGSDSDLFG → MVCSFCCCCYNFRNSPSS

Show »
Length:703
Mass (Da):77,368
Checksum:iCA37B22CA8E46A0B
GO
Isoform U (identifier: P12252-9) [UniParc]FASTAAdd to basket
Also known as: T

The sequence of this isoform differs from the canonical sequence as follows:
     1-355: Missing.
     356-385: GLHDMLKRAQGRSPLSPRISFPGSDSDLFG → MQAEQGSIGDLQKYHSRYLKNRRHTLANVR

Show »
Length:715
Mass (Da):78,887
Checksum:i595158832F5806D4
GO
Isoform I (identifier: Q9W4T4-1) [UniParc]FASTAAdd to basket
Also known as: B, S
The sequence of this isoform can be found in the external entry Q9W4T4.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:1,209
Mass (Da):129,413
GO
Isoform F (identifier: Q8IRU4-1) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q8IRU4.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:662
Mass (Da):72,954
GO
Isoform G (identifier: Q9W4S9-2) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q9W4S9.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:814
Mass (Da):89,085
GO
Isoform N (identifier: Q9W4S9-1) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q9W4S9.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:983
Mass (Da):107,341
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E2QD73E2QD73_DROME
Phosphodiesterase
dnc CG10791, CG10792, CG10797, CG14267, CG14268
1,070Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H8F4P8H8F4P8_DROME
Phosphodiesterase
dnc CG10791, CG10792, CG10797, CG14267, CG14268
1,209Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PDN2M9PDN2_DROME
Phosphodiesterase
dnc CG10791, CG10792, CG10797, CG14267, CG14268
642Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC34201 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAA38960 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAD24781 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti958D → S in CAA38960 (PubMed:1660926).Curated1
Sequence conflicti958D → S in AAC34201 (PubMed:3025834).Curated1
Sequence conflicti1027S → T in CAA38960 (PubMed:1660926).Curated1
Sequence conflicti1027S → T in AAC34201 (PubMed:3025834).Curated1
Sequence conflicti1042 – 1043SG → R in CAA38960 (PubMed:1660926).Curated2
Sequence conflicti1042 – 1043SG → R in AAC34201 (PubMed:3025834).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0045871 – 549Missing in isoform VII. 1 PublicationAdd BLAST549
Alternative sequenceiVSP_0188261 – 428Missing in isoform III. 1 PublicationAdd BLAST428
Alternative sequenceiVSP_0045851 – 369Missing in isoform IV. 1 PublicationAdd BLAST369
Alternative sequenceiVSP_0549551 – 367Missing in isoform R. 1 PublicationAdd BLAST367
Alternative sequenceiVSP_0549561 – 355Missing in isoform U. CuratedAdd BLAST355
Alternative sequenceiVSP_054957356 – 385GLHDM…SDLFG → MQAEQGSIGDLQKYHSRYLK NRRHTLANVR in isoform U. CuratedAdd BLAST30
Alternative sequenceiVSP_054958368 – 385SPLSP…SDLFG → MVCSFCCCCYNFRNSPSS in isoform R. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_004586370 – 385LSPRI…SDLFG → MVCSFCCCCYNFRNSP in isoform IV. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_004588444 – 456Missing in isoform V. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_004589493 – 494Missing in isoform VI. 1 Publication2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X55167 X55175 Genomic DNA Translation: CAA38960.1 Sequence problems.
M14982 M14981 Unassigned DNA Translation: AAC34201.1 Different initiation.
AE014298 Genomic DNA Translation: AAF45861.2
AE014298 Genomic DNA Translation: AAF45862.3
AE014298 Genomic DNA Translation: AAF45865.2
AE014298 Genomic DNA Translation: AAN09600.1
AE014298 Genomic DNA Translation: AAN09601.3
AE014298 Genomic DNA Translation: AAN09602.2
AE014298 Genomic DNA Translation: AAN09604.1
AE014298 Genomic DNA Translation: AAN09607.2
AE014298 Genomic DNA Translation: AGB95048.1
AE014298 Genomic DNA Translation: AGB95049.1
AL121800 Genomic DNA Translation: CAD24781.1 Sequence problems.
AY119511 mRNA Translation: AAM50165.1

Protein sequence database of the Protein Information Resource

More...
PIRi
S65543

NCBI Reference Sequences

More...
RefSeqi
NP_001259201.1, NM_001272272.1 [P12252-7]
NP_001259202.1, NM_001272273.1 [P12252-8]
NP_001259203.1, NM_001272274.1 [P12252-9]
NP_726849.1, NM_166961.2 [P12252-1]
NP_726850.1, NM_166962.2 [P12252-4]
NP_726851.3, NM_166963.2 [P12252-9]
NP_726852.2, NM_166964.2 [P12252-5]
NP_726853.2, NM_166965.2 [P12252-1]
NP_726854.2, NM_166966.3 [P12252-8]
NP_726855.1, NM_166967.2 [P12252-3]
NP_726857.1, NM_166969.2 [P12252-7]
NP_726859.2, NM_166971.2 [P12252-6]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0070511; FBpp0070487; FBgn0000479 [P12252-1]
FBtr0070512; FBpp0070488; FBgn0000479 [P12252-4]
FBtr0070513; FBpp0070489; FBgn0000479 [P12252-1]
FBtr0070515; FBpp0070491; FBgn0000479 [P12252-5]
FBtr0070517; FBpp0070493; FBgn0000479 [P12252-3]
FBtr0070518; FBpp0070494; FBgn0000479 [P12252-7]
FBtr0070522; FBpp0070498; FBgn0000479 [P12252-6]
FBtr0333312; FBpp0305504; FBgn0000479 [P12252-7]
FBtr0333313; FBpp0305505; FBgn0000479 [P12252-8]
FBtr0333314; FBpp0305506; FBgn0000479 [P12252-8]
FBtr0333316; FBpp0305508; FBgn0000479 [P12252-9]
FBtr0333317; FBpp0305509; FBgn0000479 [P12252-9]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
31309

UCSC genome browser

More...
UCSCi
CG32498-RA d. melanogaster [P12252-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X55167 X55175 Genomic DNA Translation: CAA38960.1 Sequence problems.
M14982 M14981 Unassigned DNA Translation: AAC34201.1 Different initiation.
AE014298 Genomic DNA Translation: AAF45861.2
AE014298 Genomic DNA Translation: AAF45862.3
AE014298 Genomic DNA Translation: AAF45865.2
AE014298 Genomic DNA Translation: AAN09600.1
AE014298 Genomic DNA Translation: AAN09601.3
AE014298 Genomic DNA Translation: AAN09602.2
AE014298 Genomic DNA Translation: AAN09604.1
AE014298 Genomic DNA Translation: AAN09607.2
AE014298 Genomic DNA Translation: AGB95048.1
AE014298 Genomic DNA Translation: AGB95049.1
AL121800 Genomic DNA Translation: CAD24781.1 Sequence problems.
AY119511 mRNA Translation: AAM50165.1
PIRiS65543
RefSeqiNP_001259201.1, NM_001272272.1 [P12252-7]
NP_001259202.1, NM_001272273.1 [P12252-8]
NP_001259203.1, NM_001272274.1 [P12252-9]
NP_726849.1, NM_166961.2 [P12252-1]
NP_726850.1, NM_166962.2 [P12252-4]
NP_726851.3, NM_166963.2 [P12252-9]
NP_726852.2, NM_166964.2 [P12252-5]
NP_726853.2, NM_166965.2 [P12252-1]
NP_726854.2, NM_166966.3 [P12252-8]
NP_726855.1, NM_166967.2 [P12252-3]
NP_726857.1, NM_166969.2 [P12252-7]
NP_726859.2, NM_166971.2 [P12252-6]

3D structure databases

SMRiP12252
ModBaseiSearch...

Protein-protein interaction databases

BioGridi57834, 17 interactors
IntActiP12252, 3 interactors

Proteomic databases

PRIDEiP12252

Genome annotation databases

EnsemblMetazoaiFBtr0070511; FBpp0070487; FBgn0000479 [P12252-1]
FBtr0070512; FBpp0070488; FBgn0000479 [P12252-4]
FBtr0070513; FBpp0070489; FBgn0000479 [P12252-1]
FBtr0070515; FBpp0070491; FBgn0000479 [P12252-5]
FBtr0070517; FBpp0070493; FBgn0000479 [P12252-3]
FBtr0070518; FBpp0070494; FBgn0000479 [P12252-7]
FBtr0070522; FBpp0070498; FBgn0000479 [P12252-6]
FBtr0333312; FBpp0305504; FBgn0000479 [P12252-7]
FBtr0333313; FBpp0305505; FBgn0000479 [P12252-8]
FBtr0333314; FBpp0305506; FBgn0000479 [P12252-8]
FBtr0333316; FBpp0305508; FBgn0000479 [P12252-9]
FBtr0333317; FBpp0305509; FBgn0000479 [P12252-9]
GeneIDi31309
UCSCiCG32498-RA d. melanogaster [P12252-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
31309
FlyBaseiFBgn0000479 dnc

Phylogenomic databases

GeneTreeiENSGT00940000155190

Enzyme and pathway databases

UniPathwayiUPA00762;UER00747

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
dnc fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
31309

Gene expression databases

BgeeiFBgn0000479 Expressed in head and 29 other tissues
ExpressionAtlasiP12252 baseline and differential
GenevisibleiP12252 DM

Family and domain databases

CDDicd00077 HDc, 1 hit
Gene3Di1.10.1300.10, 1 hit
InterProiView protein in InterPro
IPR003607 HD/PDEase_dom
IPR040844 PDE4_UCR
IPR023088 PDEase
IPR002073 PDEase_catalytic_dom
IPR036971 PDEase_catalytic_dom_sf
IPR023174 PDEase_CS
PfamiView protein in Pfam
PF18100 PDE4_UCR, 1 hit
PF00233 PDEase_I, 1 hit
PRINTSiPR00387 PDIESTERASE1
PROSITEiView protein in PROSITE
PS00126 PDEASE_I_1, 1 hit
PS51845 PDEASE_I_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPDE4B_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P12252
Secondary accession number(s): M9PGD1
, M9PGX1, O76918, Q8IRU3, Q8IRU6, Q8IRU8, Q8IRV0, Q8MRN3, Q8T8M0, Q9NF62, Q9W4S8, Q9W4T0, Q9W4T1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: August 16, 2005
Last modified: February 26, 2020
This is version 177 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again