Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 189 (22 Apr 2020)
Sequence version 2 (01 Jun 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Plasma membrane calcium-transporting ATPase 2

Gene

Atp2b2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei4994-aspartylphosphate intermediate1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi820MagnesiumBy similarity1
Metal bindingi824MagnesiumBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding, Translocase
Biological processCalcium transport, Ion transport, Transport
LigandATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.6.3.8 5301

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-418359 Reduction of cytosolic Ca++ levels
R-RNO-5578775 Ion homeostasis
R-RNO-936837 Ion transport by P-type ATPases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Plasma membrane calcium-transporting ATPase 2 (EC:7.2.2.10)
Short name:
PMCA2
Alternative name(s):
Plasma membrane calcium ATPase isoform 2
Plasma membrane calcium pump isoform 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Atp2b2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Rat genome database

More...
RGDi
2176 Atp2b2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 94CytoplasmicSequence analysisAdd BLAST94
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei95 – 115HelicalSequence analysisAdd BLAST21
Topological domaini116 – 152ExtracellularSequence analysisAdd BLAST37
Transmembranei153 – 173HelicalSequence analysisAdd BLAST21
Topological domaini174 – 390CytoplasmicSequence analysisAdd BLAST217
Transmembranei391 – 410HelicalSequence analysisAdd BLAST20
Topological domaini411 – 443ExtracellularSequence analysisAdd BLAST33
Transmembranei444 – 461HelicalSequence analysisAdd BLAST18
Topological domaini462 – 875CytoplasmicSequence analysisAdd BLAST414
Transmembranei876 – 895HelicalSequence analysisAdd BLAST20
Topological domaini896 – 905ExtracellularSequence analysis10
Transmembranei906 – 926HelicalSequence analysisAdd BLAST21
Topological domaini927 – 946CytoplasmicSequence analysisAdd BLAST20
Transmembranei947 – 969HelicalSequence analysisAdd BLAST23
Topological domaini970 – 987ExtracellularSequence analysisAdd BLAST18
Transmembranei988 – 1009HelicalSequence analysisAdd BLAST22
Topological domaini1010 – 1028CytoplasmicSequence analysisAdd BLAST19
Transmembranei1029 – 1050HelicalSequence analysisAdd BLAST22
Topological domaini1051 – 1060ExtracellularSequence analysis10
Transmembranei1061 – 1082HelicalSequence analysisAdd BLAST22
Topological domaini1083 – 1243CytoplasmicSequence analysisAdd BLAST161

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Synapse

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000462161 – 1243Plasma membrane calcium-transporting ATPase 2Add BLAST1243

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei18PhosphoserineBy similarity1
Modified residuei27PhosphoserineCombined sources1
Modified residuei1139Phosphothreonine; by PKCBy similarity1
Modified residuei1178PhosphoserineBy similarity1
Modified residuei1188PhosphothreonineCombined sources1
Modified residuei1201Phosphoserine; by PKABy similarity1
Modified residuei1211PhosphoserineBy similarity1
Isoform ZA (identifier: P11506-5)
Modified residuei1107PhosphoserineCombined sources1
Isoform ZB (identifier: P11506-8)
Modified residuei1107PhosphoserineCombined sources1
Modified residuei1116PhosphoserineCombined sources1
Modified residuei1117PhosphoserineCombined sources1
Modified residuei1130PhosphoserineCombined sources1
Isoform ZC (identifier: P11506-12)
Modified residuei1107PhosphoserineCombined sources1
Isoform XA (identifier: P11506-3)
Modified residuei1121PhosphoserineCombined sources1
Isoform XB (identifier: P11506-6)
Modified residuei1121PhosphoserineCombined sources1
Modified residuei1130PhosphoserineCombined sources1
Modified residuei1131PhosphoserineCombined sources1
Modified residuei1144PhosphoserineCombined sources1
Isoform XC (identifier: P11506-10)
Modified residuei1121PhosphoserineCombined sources1
Isoform YA (identifier: P11506-4)
Modified residuei1138PhosphoserineCombined sources1
Isoform YB (identifier: P11506-7)
Modified residuei1138PhosphoserineCombined sources1
Modified residuei1147PhosphoserineCombined sources1
Modified residuei1148PhosphoserineCombined sources1
Modified residuei1161PhosphoserineCombined sources1
Isoform YC (identifier: P11506-11)
Modified residuei1138PhosphoserineCombined sources1
Isoform WB (identifier: P11506-1)
Modified residuei1152PhosphoserineCombined sources1
Modified residuei1161PhosphoserineCombined sources1
Modified residuei1162PhosphoserineCombined sources1
Modified residuei1175PhosphoserineCombined sources1
Isoform WA (identifier: P11506-2)
Modified residuei1152PhosphoserineCombined sources1
Isoform WC (identifier: P11506-9)
Modified residuei1152PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P11506

PRoteomics IDEntifications database

More...
PRIDEi
P11506

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P11506

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P11506

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoforms containing segment B are found in brain, uterus, liver and kidney and in low levels in other tissues. Isoforms containing segment W are found in kidney, uterus, and pancreas. Isoforms containing segment Y are found in pancreas and in low levels in brain and heart. Isoforms containing segment Z are found in brain and heart and isoforms containing segment X are found in low levels in brain. Isoforms containing segment A are found in low levels in heart and small intestine while isoforms containing segment C are found in testis and in low levels in other tissues.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000030269 Expressed in brain and 7 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P11506 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PDZD11.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
246403, 2 interactors

Protein interaction database and analysis system

More...
IntActi
P11506, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000063572

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1123 – 1140Calmodulin-binding subdomain ABy similarityAdd BLAST18
Regioni1141 – 1150Calmodulin-binding subdomain BBy similarity10

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi294 – 297Poly-Glu4

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161461

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P11506

KEGG Orthology (KO)

More...
KOi
K05850

Database of Orthologous Groups

More...
OrthoDBi
115892at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P11506

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.1110.10, 1 hit
3.40.50.1000, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030322 ATP2B2
IPR022141 ATP_Ca_trans_C
IPR006068 ATPase_P-typ_cation-transptr_C
IPR004014 ATPase_P-typ_cation-transptr_N
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR006408 P-type_ATPase_IIB
IPR001757 P_typ_ATPase

The PANTHER Classification System

More...
PANTHERi
PTHR24093:SF377 PTHR24093:SF377, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12424 ATP_Ca_trans_C, 1 hit
PF00689 Cation_ATPase_C, 1 hit
PF00690 Cation_ATPase_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00831 Cation_ATPase_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56784 SSF56784, 1 hit
SSF81653 SSF81653, 1 hit
SSF81660 SSF81660, 1 hit
SSF81665 SSF81665, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01517 ATPase-IIB_Ca, 1 hit
TIGR01494 ATPase_P-type, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (14+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 14 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: There is a combination of two alternatively spliced domains at N-terminal site A (W, X, Y and Z) and at C-terminal site C (A, B and C). So far the splice sites have only been studied independently. Experimental confirmation may be lacking for some isoforms.

This entry has 14 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P11506-13) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGDMTNSDFY SKNQRNESSH GGEFGCSMEE LRSLMELRGT EAVVKIKETY
60 70 80 90 100
GDTESICRRL KTSPVEGLPG TAPDLEKRKQ IFGQNFIPPK KPKTFLQLVW
110 120 130 140 150
EALQDVTLII LEIAAIISLG LSFYHPPGES NEGCATAQGG AEDEGEAEAG
160 170 180 190 200
WIEGAAILLS VICVVLVTAF NDWSKEKQFR GLQSRIEQEQ KFTVVRAGQV
210 220 230 240 250
VQIPVAEIVV GDIAQIKYGD LLPADGLFIQ GNDLKIDESS LTGESDQVRK
260 270 280 290 300
SVDKDPMLLS GTHVMEGSGR MVVTAVGVNS QTGIIFTLLG AGGEEEEKKD
310 320 330 340 350
KKGVKKGDGL QLPAADGAAP ANAAGSANAS LVNGKMQDGS ADSSQSKAKQ
360 370 380 390 400
QDGAAAMEMQ PLKSAEGGDA DDKKKANMHK KEKSVLQGKL TKLAVQIGKA
410 420 430 440 450
GLVMSAITVI ILVLYFTVDT FVVNKKPWLT ECTPVYVQYF VKFFIIGVTV
460 470 480 490 500
LVVAVPEGLP LAVTISLAYS VKKMMKDNNL VRHLDACETM GNATAICSDK
510 520 530 540 550
TGTLTTNRMT VVQAYVGDVH YKEIPDPSSI NAKTLELLVN AIAINSAYTT
560 570 580 590 600
KILPPEKEGA LPRQVGNKTE CGLLGFVLDL RQDYEPVRSQ MPEEKLYKVY
610 620 630 640 650
TFNSVRKSMS TVIKMPDESF RMYSKGASEI VLKKCCKILS GAGEPRVFRP
660 670 680 690 700
RDRDEMVKKV IEPMACDGLR TICVAYRDFP SSPEPDWDNE NDILNELTCI
710 720 730 740 750
CVVGIEDPVR PEVPEAIRKC QRAGITVRMV TGDNINTARA IAIKCGIIHP
760 770 780 790 800
GEDFLCLEGK EFNRRIRNEK GEIEQERIDK IWPKLRVLAR SSPTDKHTLV
810 820 830 840 850
KGIIDSTHTE QRQVVAVTGD GTNDGPALKK ADVGFAMGIA GTDVAKEASD
860 870 880 890 900
IILTDDNFSS IVKAVMWGRN VYDSISKFLQ FQLTVNVVAV IVAFTGACIT
910 920 930 940 950
QDSPLKAVQM LWVNLIMDTF ASLALATEPP TETLLLRKPY GRNKPLISRT
960 970 980 990 1000
MMKNILGHAV YQLTLIFTLL FVGEKMFQID SGRNAPLHSP PSEHYTIIFN
1010 1020 1030 1040 1050
TFVMMQLFNE INARKIHGER NVFDGIFRNP IFCTIVLGTF AIQIVIVQFG
1060 1070 1080 1090 1100
GKPFSCSPLQ LDQWMWCIFI GLGELVWGQV IATIPTSRLK FLKEAGRLTQ
1110 1120 1130 1140 1150
KEEIPEEELN EDVEEIDHAE RELRRGQILW FRGLNRIQTQ IRVVKAFRSS
1160 1170 1180 1190 1200
LYEGLEKPES RTSIHNFMAH PEFRIEDSQP HIPLIDDTDL EEDAALKQNS
1210 1220 1230 1240
SPPSSLNKNN SAIDSGINLT TDTSKSATSS SPGSPIHSLE TSL
Length:1,243
Mass (Da):136,811
Last modified:June 1, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1DC324836BFD5D59
GO
Isoform WB (identifier: P11506-1) [UniParc]FASTAAdd to basket
Also known as: AIIICI

The sequence of this isoform differs from the canonical sequence as follows:
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.

Show »
Length:1,257
Mass (Da):138,245
Checksum:iFA4413080598ABF8
GO
Isoform WA (identifier: P11506-2) [UniParc]FASTAAdd to basket
Also known as: AIIICII

The sequence of this isoform differs from the canonical sequence as follows:
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

Show »
Length:1,199
Mass (Da):131,552
Checksum:i702E8C5EE0D003B4
GO
Isoform XA (identifier: P11506-3) [UniParc]FASTAAdd to basket
Also known as: AIICII

The sequence of this isoform differs from the canonical sequence as follows:
     303-333: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

Show »
Length:1,168
Mass (Da):128,764
Checksum:i6AB32E12491365BB
GO
Isoform YA (identifier: P11506-4) [UniParc]FASTAAdd to basket
Also known as: AIIICII

The sequence of this isoform differs from the canonical sequence as follows:
     334-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

Show »
Length:1,185
Mass (Da):130,145
Checksum:i5D4B80A8A5627C1E
GO
Isoform ZA (identifier: P11506-5) [UniParc]FASTAAdd to basket
Also known as: AICII

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

Show »
Length:1,154
Mass (Da):127,357
Checksum:i22BF0F734827E168
GO
Isoform XB (identifier: P11506-6) [UniParc]FASTAAdd to basket
Also known as: AIICI

The sequence of this isoform differs from the canonical sequence as follows:
     303-333: Missing.
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.

Show »
Length:1,226
Mass (Da):135,457
Checksum:iC1C8678C84C5A81D
GO
Isoform YB (identifier: P11506-7) [UniParc]FASTAAdd to basket
Also known as: AIIICI

The sequence of this isoform differs from the canonical sequence as follows:
     334-347: Missing.
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.

Show »
Length:1,243
Mass (Da):136,837
Checksum:iCD227EBA699DEE58
GO
Isoform ZB (identifier: P11506-8) [UniParc]FASTAAdd to basket
Also known as: AICI

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.

Show »
Length:1,212
Mass (Da):134,049
Checksum:iD1FFFEB5C78AE637
GO
Isoform WC (identifier: P11506-9) [UniParc]FASTAAdd to basket
Also known as: AIIICIII

The sequence of this isoform differs from the canonical sequence as follows:
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

Show »
Length:1,205
Mass (Da):132,296
Checksum:i894D6AD40637CF29
GO
Isoform XC (identifier: P11506-10) [UniParc]FASTAAdd to basket
Also known as: AIICIII

The sequence of this isoform differs from the canonical sequence as follows:
     303-333: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

Show »
Length:1,174
Mass (Da):129,508
Checksum:i644AC852899E45B4
GO
Isoform YC (identifier: P11506-11) [UniParc]FASTAAdd to basket
Also known as: AIIICIII

The sequence of this isoform differs from the canonical sequence as follows:
     334-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

Show »
Length:1,191
Mass (Da):130,889
Checksum:i8291A1522E47024C
GO
Isoform ZC (identifier: P11506-12) [UniParc]FASTAAdd to basket
Also known as: AICIII

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

Show »
Length:1,160
Mass (Da):128,101
Checksum:i53A179C997F3DDB8
GO
Isoform 2 (identifier: P11506-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.

Show »
Length:1,198
Mass (Da):132,616
Checksum:i0362C0738CFA439F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D4A8B3D4A8B3_RAT
Calcium-transporting ATPase
Atp2b2
1,199Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000388303 – 347Missing in isoform 2, isoform ZA, isoform ZB and isoform ZC. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_000387303 – 333Missing in isoform XA, isoform XB and isoform XC. CuratedAdd BLAST31
Alternative sequenceiVSP_000389334 – 347Missing in isoform YA, isoform YB and isoform YC. CuratedAdd BLAST14
Alternative sequenceiVSP_0003901141 – 1243IRVVK…LETSL → IEVVNTFKSGASFQGALRRQ SSVTSQSQDVANLSSPSRVS LSNALSSPTSLPPAAAGQG in isoform WA, isoform XA, isoform YA and isoform ZA. CuratedAdd BLAST103
Alternative sequenceiVSP_0003911141 – 1243IRVVK…LETSL → IEVVNTFKSGASFQGALRRQ SSVTSQSQDVANLSSPSRVS LSNALSSPTSLPPAAAGHPR REGVP in isoform WC, isoform XC, isoform YC and isoform ZC. CuratedAdd BLAST103
Alternative sequenceiVSP_0386811141I → IEVVNTFKSGASFQGALRRQ SSVTSQSQDVASLSSPSRVS LSNALSSPTSLPPAAAGI in isoform WB, isoform XB, isoform YB and isoform ZB. Curated1
Alternative sequenceiVSP_0386821201 – 1243Missing in isoform WB, isoform XB, isoform YB and isoform ZB. CuratedAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
J03754 mRNA Translation: AAA74219.1
AH005430 Genomic DNA Translation: AAB60703.1

Protein sequence database of the Protein Information Resource

More...
PIRi
B28065

NCBI Reference Sequences

More...
RefSeqi
NP_036640.1, NM_012508.5 [P11506-14]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000067931; ENSRNOP00000060489; ENSRNOG00000030269 [P11506-14]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
24215

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:24215

UCSC genome browser

More...
UCSCi
RGD:2176 rat [P11506-13]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J03754 mRNA Translation: AAA74219.1
AH005430 Genomic DNA Translation: AAB60703.1
PIRiB28065
RefSeqiNP_036640.1, NM_012508.5 [P11506-14]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi246403, 2 interactors
IntActiP11506, 1 interactor
STRINGi10116.ENSRNOP00000063572

PTM databases

iPTMnetiP11506
PhosphoSitePlusiP11506

Proteomic databases

jPOSTiP11506
PRIDEiP11506

Genome annotation databases

EnsembliENSRNOT00000067931; ENSRNOP00000060489; ENSRNOG00000030269 [P11506-14]
GeneIDi24215
KEGGirno:24215
UCSCiRGD:2176 rat [P11506-13]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
491
RGDi2176 Atp2b2

Phylogenomic databases

GeneTreeiENSGT00940000161461
InParanoidiP11506
KOiK05850
OrthoDBi115892at2759
PhylomeDBiP11506

Enzyme and pathway databases

BRENDAi3.6.3.8 5301
ReactomeiR-RNO-418359 Reduction of cytosolic Ca++ levels
R-RNO-5578775 Ion homeostasis
R-RNO-936837 Ion transport by P-type ATPases

Miscellaneous databases

Protein Ontology

More...
PROi
PR:P11506

Gene expression databases

BgeeiENSRNOG00000030269 Expressed in brain and 7 other tissues
ExpressionAtlasiP11506 baseline and differential

Family and domain databases

Gene3Di3.40.1110.10, 1 hit
3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR030322 ATP2B2
IPR022141 ATP_Ca_trans_C
IPR006068 ATPase_P-typ_cation-transptr_C
IPR004014 ATPase_P-typ_cation-transptr_N
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR006408 P-type_ATPase_IIB
IPR001757 P_typ_ATPase
PANTHERiPTHR24093:SF377 PTHR24093:SF377, 1 hit
PfamiView protein in Pfam
PF12424 ATP_Ca_trans_C, 1 hit
PF00689 Cation_ATPase_C, 1 hit
PF00690 Cation_ATPase_N, 1 hit
SMARTiView protein in SMART
SM00831 Cation_ATPase_N, 1 hit
SUPFAMiSSF56784 SSF56784, 1 hit
SSF81653 SSF81653, 1 hit
SSF81660 SSF81660, 1 hit
SSF81665 SSF81665, 1 hit
TIGRFAMsiTIGR01517 ATPase-IIB_Ca, 1 hit
TIGR01494 ATPase_P-type, 3 hits
PROSITEiView protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAT2B2_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P11506
Secondary accession number(s): Q63443
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: June 1, 2001
Last modified: April 22, 2020
This is version 189 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again