Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 194 (13 Nov 2019)
Sequence version 3 (12 Sep 2018)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Plasma membrane calcium-transporting ATPase 1

Gene

Atp2b1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the hydrolysis of ATP coupled with the transport of calcium from the cytoplasm to the extracellular space thereby maintaining intracellular calcium homeostasis. Plays a role in blood pressure regulation through regulation of intracellular calcium concentration and nitric oxide production leading to regulation of vascular smooth muscle cells vasoconstriction. Positively regulates bone mineralization through absorption of calcium from the intestine. Plays dual roles in osteoclast differentiation and survival by regulating RANKL-induced calcium oscillations in preosteoclasts and mediating calcium extrusion in mature osteoclasts (By similarity). Regulates insulin sensitivity through calcium/calmodulin signaling pathway by regulating AKT1 activation and NOS3 activation in endothelial cells (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei4754-aspartylphosphate intermediateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi475MagnesiumBy similarity1
Metal bindingi477Magnesium; via carbonyl oxygenBy similarity1
Metal bindingi797MagnesiumBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding, Translocase
Biological processCalcium transport, Ion transport, Transport
LigandATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-418359 Reduction of cytosolic Ca++ levels
R-RNO-5578775 Ion homeostasis
R-RNO-936837 Ion transport by P-type ATPases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Plasma membrane calcium-transporting ATPase 1Curated (EC:7.2.2.10By similarity)
Alternative name(s):
Plasma membrane calcium ATPase isoform 11 Publication
Short name:
PMCA11 Publication
Plasma membrane calcium pump isoform 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Atp2b1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Rat genome database

More...
RGDi
621303 Atp2b1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini2 – 105CytoplasmicCuratedAdd BLAST104
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei106 – 126HelicalBy similarityAdd BLAST21
Topological domaini127 – 154ExtracellularCuratedAdd BLAST28
Transmembranei155 – 175HelicalBy similarityAdd BLAST21
Topological domaini176 – 366CytoplasmicCuratedAdd BLAST191
Transmembranei367 – 386HelicalBy similarityAdd BLAST20
Topological domaini387 – 418ExtracellularCuratedAdd BLAST32
Transmembranei419 – 439HelicalSequence analysisAdd BLAST21
Topological domaini440 – 855CytoplasmicCuratedAdd BLAST416
Transmembranei856 – 876HelicalSequence analysisAdd BLAST21
Topological domaini877 – 882ExtracellularCurated6
Transmembranei883 – 903HelicalSequence analysisAdd BLAST21
Topological domaini904 – 927CytoplasmicCuratedAdd BLAST24
Transmembranei928 – 948HelicalBy similarityAdd BLAST21
Topological domaini949 – 971ExtracellularCuratedAdd BLAST23
Transmembranei972 – 991HelicalBy similarityAdd BLAST20
Topological domaini992 – 1005CytoplasmicCuratedAdd BLAST14
Transmembranei1006 – 1027HelicalBy similarityAdd BLAST22
Topological domaini1028 – 1039ExtracellularCuratedAdd BLAST12
Transmembranei1040 – 1060HelicalBy similarityAdd BLAST21
Topological domaini1061 – 1220CytoplasmicCuratedAdd BLAST160

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Synapse

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000462122 – 1220Plasma membrane calcium-transporting ATPase 1Add BLAST1219

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylglycineBy similarity1
Modified residuei8PhosphoserineBy similarity1
Modified residuei17PhosphoserineCombined sources1
Modified residuei338PhosphoserineBy similarity1
Modified residuei1116Phosphothreonine; by PKCBy similarity1
Modified residuei1140PhosphoserineCombined sources1
Modified residuei1155PhosphoserineBy similarity1
Modified residuei1165PhosphothreonineBy similarity1
Modified residuei1177Phosphoserine; by PKABy similarity1
Modified residuei1178PhosphoserineBy similarity1
Modified residuei1182PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P11505

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P11505

PRoteomics IDEntifications database

More...
PRIDEi
P11505

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P11505

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P11505

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P11505

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform B is ubiquitously expressed. Isoforms A and E have only been found in brain cortex. Isoform C is found in brain cortex, skeletal muscle and heart muscle. Isoform D has only been found in fetal skeletal muscle. Isoform K has been found in small intestine and liver. Isoform B is expressed in hair cells of inner ear (PubMed:16803870).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000004026 Expressed in 9 organ(s), highest expression level in Ammon's horn

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P11505 RN

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer. Dimer. Oligomer. Calmodulin binding.

Interacts with PDZD11.

Interacts with SLC35G1 and STIM1.

Interacts with YWHAE; interacts with the monomeric and dimeric forms of the YWHAE but prefer the monomer form; this interaction inhibits calcium-transporting ATPase activity (By similarity).

Interacts with NPTN; this interaction stabilizes ATP2B1 and increases ATPase activity; this interaction controls T cell calcium homeostasis following T cell activation.

Interacts with EPB41; regulates small intestinal calcium absorption through regulation of membrane expression of ATP2B1 (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
248230, 5 interactors

Protein interaction database and analysis system

More...
IntActi
P11505, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000005491

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1100 – 1117Calmodulin-binding subdomain ABy similarityAdd BLAST18
Regioni1118 – 1220Required for basolateral membrane targeting1 PublicationAdd BLAST103

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi296 – 299Poly-Glu4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Isoforms A, C, D and E contain and additional calmodulin-binding subdomain B which is different in the different splice variants and shows pH dependent calmodulin binding properties.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0204 Eukaryota
ENOG410XNNC LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158686

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000265623

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P11505

KEGG Orthology (KO)

More...
KOi
K05850

Identification of Orthologs from Complete Genome Data

More...
OMAi
IIPRLHV

Database of Orthologous Groups

More...
OrthoDBi
115892at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P11505

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.1110.10, 1 hit
3.40.50.1000, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030320 ATP2B1
IPR022141 ATP_Ca_trans_C
IPR006068 ATPase_P-typ_cation-transptr_C
IPR004014 ATPase_P-typ_cation-transptr_N
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR006408 P-type_ATPase_IIB
IPR001757 P_typ_ATPase

The PANTHER Classification System

More...
PANTHERi
PTHR24093:SF245 PTHR24093:SF245, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12424 ATP_Ca_trans_C, 1 hit
PF00689 Cation_ATPase_C, 1 hit
PF00690 Cation_ATPase_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00831 Cation_ATPase_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56784 SSF56784, 1 hit
SSF81653 SSF81653, 1 hit
SSF81660 SSF81660, 1 hit
SSF81665 SSF81665, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01517 ATPase-IIB_Ca, 1 hit
TIGR01494 ATPase_P-type, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform B (identifier: P11505-3) [UniParc]FASTAAdd to basket
Also known as: CI

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGDMANNSVA YSGVKNSLKE ANHDGDFGIT LAELRALMEL RSTDALRKIQ
60 70 80 90 100
ESYGDVYGIC TKLKTSPNEG LSGNPADLER REAVFGKNFI PPKKPKTFLQ
110 120 130 140 150
LVWEALQDVT LIILEIAAIV SLGLSFYQPP EGDNALCGEV SVGEEEGEGE
160 170 180 190 200
TGWIEGAAIL LSVVCVVLVT AFNDWSKEKQ FRGLQSRIEQ EQKFTVIRGG
210 220 230 240 250
QVIQIPVADI TVGDIAQVKY GDLLPADGIL IQGNDLKIDE SSLTGESDHV
260 270 280 290 300
KKSLDKDPLL LSGTHVMEGS GRMVVTAVGV NSQTGIIFTL LGAGGEEEEK
310 320 330 340 350
KDEKKKEKKN KKQDGAIENR NKAKAQDGAA MEMQPLKSEE GGDGDEKDKK
360 370 380 390 400
KANLPKKEKS VLQGKLTKLA VQIGKAGLLM SAITVIILVL YFVIDTFWVQ
410 420 430 440 450
KRPWLAECTP IYIQYFVKFF IIGVTVLVVA VPEGLPLAVT ISLAYSVKKM
460 470 480 490 500
MKDNNLVRHL DACETMGNAT AICSDKTGTL TMNRMTVVQA YINEKHYKKV
510 520 530 540 550
PEPEAIPPNI LSYLVTGISV NCAYTSKILP PEKEGGLPRH VGNKTECALL
560 570 580 590 600
GFLLDLKRDY QDVRNEIPEE ALYKVYTFNS VRKSMSTVLK NSDGSFRIFS
610 620 630 640 650
KGASEIILKK CFKILSANGE AKVFRPRDRD DIVKTVIEPM ASEGLRTICL
660 670 680 690 700
AFRDFPAGEP EPEWDNENDV VTGLTCIAVV GIEDPVRPEV PEAIKKCQRA
710 720 730 740 750
GITVRMVTGD NINTARAIAT KCGILHPGED FLCLEGKDFN RRIRNEKGEI
760 770 780 790 800
EQERIDKIWP KLRVLARSSP TDKHTLVKGI IDSTVSEQRQ VVAVTGDGTN
810 820 830 840 850
DGPALKKADV GFAMGIAGTD VAKEASDIIL TDDNFTSIVK AVMWGRNVYD
860 870 880 890 900
SISKFLQFQL TVNVVAVIVA FTGACITQDS PLKAVQMLWV NLIMDTLASL
910 920 930 940 950
ALATEPPTES LLLRKPYGRN KPLISRTMMK NILGHAFYQL VVVFTLLFAG
960 970 980 990 1000
EKFFDIDSGR NAPLHAPPSE HYTIVFNTFV LMQLFNEINA RKIHGERNVF
1010 1020 1030 1040 1050
EGIFNNAIFC TIVLGTFVVQ IIIVQFGGKP FSCSELSIEQ WLWSIFLGMG
1060 1070 1080 1090 1100
TLLWGQLIST IPTSRLKFLK EAGHGTQKEE IPEEELAEDV EEIDHAEREL
1110 1120 1130 1140 1150
RRGQILWFRG LNRIQTQIRV VNAFRSSLYE GLEKPESRSS IHNFMTHPEF
1160 1170 1180 1190 1200
RIEDSEPLIP LIDDTDAEDD APTKRNSSPP PSPNKNNNAV DSGIHLTIEM
1210 1220
NKSATSSSPG SPLHSLETSL
Length:1,220
Mass (Da):134,693
Last modified:September 12, 2018 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i29BD18FC2B024746
GO
Isoform D (identifier: P11505-1) [UniParc]FASTAAdd to basket
Also known as: CIV

The sequence of this isoform differs from the canonical sequence as follows:
     1117-1117: Q → QMDVVNAFQSGGSIQGALRRQPSIASQHHDVTNVSTPTH

Show »
Length:1,258
Mass (Da):138,719
Checksum:iD1F19DC331F76B61
GO
Isoform A (identifier: P11505-2) [UniParc]FASTAAdd to basket
Also known as: CII

The sequence of this isoform differs from the canonical sequence as follows:
     1118-1119: IR → MD
     1125-1220: RSSLYEGLEK...SPLHSLETSL → QSGGSIQGAL...VGYPSGECIS

Show »
Length:1,176
Mass (Da):129,510
Checksum:i96F8E55209C51F2B
GO
Isoform C (identifier: P11505-4) [UniParc]FASTAAdd to basket
Also known as: CIII

The sequence of this isoform differs from the canonical sequence as follows:
     1117-1117: Q → QMDVVNAFQSGGSIQGALRRQPSIASQHHD

Show »
Length:1,249
Mass (Da):137,782
Checksum:i9DFE64B0DE56EAB5
GO
Isoform E (identifier: P11505-5) [UniParc]FASTAAdd to basket
Also known as: CV

The sequence of this isoform differs from the canonical sequence as follows:
     1118-1119: IR → MD
     1125-1220: RSSLYEGLEK...SPLHSLETSL → QSGGSIQGAL...TASTPVGSEW

Show »
Length:1,171
Mass (Da):129,076
Checksum:iB3C355489CBA0FE2
GO
Isoform K (identifier: P11505-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1021-1056: Missing.

Show »
Length:1,184
Mass (Da):130,625
Checksum:iC93FBF49CB01B7D2
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA50878 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform D (identifier: P11505-1)
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1125Q → R in AAD46085 (PubMed:10858669).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0597801021 – 1056Missing in isoform K. Add BLAST36
Alternative sequenceiVSP_0597811117Q → QMDVVNAFQSGGSIQGALRR QPSIASQHHD in isoform C. 1
Alternative sequenceiVSP_0597821117Q → QMDVVNAFQSGGSIQGALRR QPSIASQHHDVTNVSTPTH in isoform D. 1
Alternative sequenceiVSP_0597831118 – 1119IR → MD in isoform A and isoform E. 2
Alternative sequenceiVSP_0597841125 – 1220RSSLY…LETSL → QSGGSIQGALRRQPSIASQH HDVTNVSTPTHVVFSSSTAS TPVGYPSGECIS in isoform A. Add BLAST96
Alternative sequenceiVSP_0597851125 – 1220RSSLY…LETSL → QSGGSIQGALRRQPSIASQH HDVTNVSTPTHVVFSSSTAS TPVGSEW in isoform E. Add BLAST96

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
J03753 mRNA Translation: AAA73898.1
L04739 Genomic DNA Translation: AAA50878.1 Sequence problems.
AF076783 mRNA Translation: AAD46085.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A28065
D45213

NCBI Reference Sequences

More...
RefSeqi
NP_445763.1, NM_053311.1 [P11505-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000041354; ENSRNOP00000040092; ENSRNOG00000004026 [P11505-2]
ENSRNOT00000066174; ENSRNOP00000059397; ENSRNOG00000004026 [P11505-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29598

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:29598

UCSC genome browser

More...
UCSCi
RGD:621303 rat [P11505-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J03753 mRNA Translation: AAA73898.1
L04739 Genomic DNA Translation: AAA50878.1 Sequence problems.
AF076783 mRNA Translation: AAD46085.1
PIRiA28065
D45213
RefSeqiNP_445763.1, NM_053311.1 [P11505-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi248230, 5 interactors
IntActiP11505, 1 interactor
STRINGi10116.ENSRNOP00000005491

PTM databases

iPTMnetiP11505
PhosphoSitePlusiP11505
SwissPalmiP11505

Proteomic databases

jPOSTiP11505
PaxDbiP11505
PRIDEiP11505

Genome annotation databases

EnsembliENSRNOT00000041354; ENSRNOP00000040092; ENSRNOG00000004026 [P11505-2]
ENSRNOT00000066174; ENSRNOP00000059397; ENSRNOG00000004026 [P11505-2]
GeneIDi29598
KEGGirno:29598
UCSCiRGD:621303 rat [P11505-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
490
RGDi621303 Atp2b1

Phylogenomic databases

eggNOGiKOG0204 Eukaryota
ENOG410XNNC LUCA
GeneTreeiENSGT00940000158686
HOGENOMiHOG000265623
InParanoidiP11505
KOiK05850
OMAiIIPRLHV
OrthoDBi115892at2759
PhylomeDBiP11505

Enzyme and pathway databases

ReactomeiR-RNO-418359 Reduction of cytosolic Ca++ levels
R-RNO-5578775 Ion homeostasis
R-RNO-936837 Ion transport by P-type ATPases

Miscellaneous databases

Protein Ontology

More...
PROi
PR:P11505

Gene expression databases

BgeeiENSRNOG00000004026 Expressed in 9 organ(s), highest expression level in Ammon's horn
GenevisibleiP11505 RN

Family and domain databases

Gene3Di3.40.1110.10, 1 hit
3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR030320 ATP2B1
IPR022141 ATP_Ca_trans_C
IPR006068 ATPase_P-typ_cation-transptr_C
IPR004014 ATPase_P-typ_cation-transptr_N
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR006408 P-type_ATPase_IIB
IPR001757 P_typ_ATPase
PANTHERiPTHR24093:SF245 PTHR24093:SF245, 1 hit
PfamiView protein in Pfam
PF12424 ATP_Ca_trans_C, 1 hit
PF00689 Cation_ATPase_C, 1 hit
PF00690 Cation_ATPase_N, 1 hit
SMARTiView protein in SMART
SM00831 Cation_ATPase_N, 1 hit
SUPFAMiSSF56784 SSF56784, 1 hit
SSF81653 SSF81653, 1 hit
SSF81660 SSF81660, 1 hit
SSF81665 SSF81665, 1 hit
TIGRFAMsiTIGR01517 ATPase-IIB_Ca, 1 hit
TIGR01494 ATPase_P-type, 3 hits
PROSITEiView protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAT2B1_RAT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P11505
Secondary accession number(s): Q63442, Q9R1L7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: September 12, 2018
Last modified: November 13, 2019
This is version 194 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again