Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P11473 (VDR_HUMAN)

Entry version 242 (10 Feb 2021)
Sequence version 1 (01 Oct 1989)
Previous versions | rss
Add a publicationFeedback
Protein

Vitamin D3 receptor

Gene

VDR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Nuclear receptor for calcitriol, the active form of vitamin D3 which mediates the action of this vitamin on cells (PubMed:28698609, PubMed:16913708, PubMed:15728261, PubMed:10678179). Enters the nucleus upon vitamin D3 binding where it forms heterodimers with the retinoid X receptor/RXR (PubMed:28698609). The VDR-RXR heterodimers bind to specific response elements on DNA and activate the transcription of vitamin D3-responsive target genes (PubMed:28698609). Plays a central role in calcium homeostasis (By similarity).By similarity4 Publications

Caution

It is uncertain whether Met-1 or Met-4 is the initiator.Curated
Was thought to be recruited to promoters via its interaction with BAZ1B/WSTF, but this work has later been retracted.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei143Vitamin D31
Binding sitei305Vitamin D31
Binding sitei397Vitamin D31

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi21 – 96Nuclear receptorPROSITE-ProRule annotationAdd BLAST76
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri24 – 44NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri60 – 84NR C4-typePROSITE-ProRule annotationAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Receptor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P11473

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-196791, Vitamin D (calciferol) metabolism
R-HSA-383280, Nuclear Receptor transcription pathway
R-HSA-4090294, SUMOylation of intracellular receptors

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P11473

SIGNOR Signaling Network Open Resource

More...SIGNORi		P11473

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...MoonDBi		P11473, Predicted

Transport Classification Database

More...TCDBi		9.B.208.1.1, the vitamin d3 receptor (vdr) family

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001571

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Vitamin D3 receptor
Short name:
VDR
Alternative name(s):
1,25-dihydroxyvitamin D3 receptor
Nuclear receptor subfamily 1 group I member 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:VDR
Synonyms:NR1I1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:12679, VDR

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		601769, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P11473

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000111424.10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Rickets vitamin D-dependent 2A (VDDR2A)12 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA disorder of vitamin D metabolism resulting in severe rickets, hypocalcemia and secondary hyperparathyroidism. Most patients have total alopecia in addition to rickets.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_00465633G → D in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909790EnsemblClinVar.1
Natural variantiVAR_00465735H → Q in VDDR2A. 1 Publication1
Natural variantiVAR_00465845K → E in VDDR2A. 1 Publication1
Natural variantiVAR_00465946G → D in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909797EnsemblClinVar.1
Natural variantiVAR_00466047F → I in VDDR2A. 1 Publication1
Natural variantiVAR_00466150R → Q in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909794EnsemblClinVar.1
Natural variantiVAR_00466273R → Q in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909791EnsemblClinVar.1
Natural variantiVAR_00466380R → Q in VDDR2A. 2 PublicationsCorresponds to variant dbSNP:rs121909793EnsemblClinVar.1
Natural variantiVAR_079325152 – 427Missing in VDDR2A; loss of calcitriol receptor activity; loss of affinity for calcitriol; no effect on ligand-independent localization to the nucleus. 2 PublicationsCorresponds to variant dbSNP:rs121909795Add BLAST276
Natural variantiVAR_004664274R → L in VDDR2A; loss of calcitriol receptor activity; decreased affinity for calcitriol by a factor of 1000; no effect on interaction with RXRA; changed interaction with NCOR1; loss of interaction with NCOA1; no effect on sequence-specific DNA-binding. 2 PublicationsCorresponds to variant dbSNP:rs121909796EnsemblClinVar.1
Natural variantiVAR_004665305H → Q in VDDR2A; loss of calcitriol receptor activity; no effect on interaction with RXRA; changed interaction with NCOR1; loss of interaction with NCOA1; no effect on sequence-specific DNA-binding. 2 PublicationsCorresponds to variant dbSNP:rs121909798EnsemblClinVar.1
Natural variantiVAR_004666314I → S in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909799EnsemblClinVar.1
Natural variantiVAR_079326346V → M in VDDR2A; decreased calcitriol receptor activity; decreased affinity for calcitriol; decreased ligand-independent localization to the nucleus; loss of interaction with RXRA; decreased interaction with NCOR1; decreased interaction with NCOA1; decreased sequence-specific DNA-binding. 2 PublicationsCorresponds to variant dbSNP:rs267607169EnsemblClinVar.1
Natural variantiVAR_079327360S → P in VDDR2A; loss of calcitriol receptor activity; loss of affinity for calcitriol; decreased ligand-independent localization to the nucleus; loss of interaction with RXRA; loss of interaction with NCOR1; loss of interaction with NCOA1; loss of sequence-specific DNA-binding. 1 Publication1
Natural variantiVAR_004667391R → C in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909800EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi47 – 48FF → AA: Abolishes nuclear export. 1 Publication2
Mutagenesisi61 – 62PF → AA: Promotes heterodimerization with RXRA; when associated with A-75. 1 Publication2
Mutagenesisi75H → A: Promotes heterodimerization with RXRA; when associated with A-61 and A-62. 1 Publication1

Keywords - Diseasei

Disease variant

Organism-specific databases

DisGeNET

More...DisGeNETi		7421

MalaCards human disease database

More...MalaCardsi		VDR
MIMi277440, phenotype
607948, phenotype

Open Targets

More...OpenTargetsi		ENSG00000111424

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		93160, Hypocalcemic vitamin D-resistant rickets

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA37301

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P11473, Tclin

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1977

Drug and drug target database

More...DrugBanki		DB07530, (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-trimethyl-3-[6,6,6-trifluoro-5-hydroxy-5-(trifluoromethyl)hex-3-yn-1-yl]cyclopentyl}prop-2-en-1-ylidene]cyclohexane-1,3-diol
DB08742, 1,3-CYCLOHEXANEDIOL, 4-METHYLENE-5-[(2E)-[(1S,3AS,7AS)-OCTAHYDRO-1-(5-HYDROXY-5-METHYL-1,3-HEXADIYNYL)-7A-METHYL-4H-INDEN-4-YLIDENE]ETHYLIDENE]-, (1R,3S,5Z)
DB01436, Alfacalcidol
DB04891, Becocalcidiol
DB00146, Calcifediol
DB02300, Calcipotriol
DB00136, Calcitriol
DB00169, Cholecalciferol
DB04540, Cholesterol
DB05024, CTA018
DB11672, Curcumin
DB14635, Curcumin sulfate
DB01070, Dihydrotachysterol
DB06410, Doxercalciferol
DB05295, Eldecalcitol
DB06194, Elocalcitol
DB00153, Ergocalciferol
DB04796, Inecalcitol
DB03451, Lexacalcitol
DB00910, Paricalcitol
DB04258, Seocalcitol
DB11094, Vitamin D

DrugCentral

More...DrugCentrali		P11473

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		605

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		VDR

Domain mapping of disease mutations (DMDM)

More...DMDMi		137617

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000535421 – 427Vitamin D3 receptorAdd BLAST427

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P11473

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P11473

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P11473

MaxQB - The MaxQuant DataBase

More...MaxQBi		P11473

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P11473

PeptideAtlas

More...PeptideAtlasi		P11473

PRoteomics IDEntifications database

More...PRIDEi		P11473

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		32456
52780 [P11473-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P11473

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P11473

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000111424, Expressed in tibia and 195 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P11473, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P11473, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000111424, Tissue enhanced (intestine, parathyroid gland)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer in the absence of bound vitamin D3 (PubMed:11980721). Heterodimer with RXRA after vitamin D3 binding (PubMed:15225774, PubMed:11980721, PubMed:10678179).

Interacts with MED1, NCOA1, NCOA2, NCOA3 and NCOA6 coactivators, leading to a strong increase of transcription of target genes (PubMed:10866662, PubMed:15728261, PubMed:28698609, PubMed:9267036).

Interacts with the corepressor NCOR1 (PubMed:28698609).

Interacts with SNW1 (PubMed:9632709).

Interacts with IRX4, the interaction does not affect its transactivation activity (PubMed:22323358).

Interacts with CRY1 (By similarity).

Interacts with CRY2 in a ligand-dependent manner (By similarity).

By similarity9 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		113264, 103 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-631, RXRalpha-VDR nuclear hormone receptor complex
CPX-871, RXRbeta-VDR nuclear hormone receptor complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P11473

Database of interacting proteins

More...DIPi		DIP-32624N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		P11473

Protein interaction database and analysis system

More...IntActi		P11473, 34 interactors

Molecular INTeraction database

More...MINTi		P11473

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000447173

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P11473

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P11473, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1427
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P11473

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P11473

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini127 – 423NR LBDPROSITE-ProRule annotationAdd BLAST297

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni97 – 126HingeAdd BLAST30
Regioni227 – 237Vitamin D3 bindingAdd BLAST11
Regioni271 – 278Vitamin D3 binding8

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi416 – 4249aaTAD1 Publication9

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.
The 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the nuclear hormone receptor family. NR1 subfamily.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri24 – 44NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri60 – 84NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3575, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155473

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P11473

Identification of Orthologs from Complete Genome Data

More...OMAi		YADFTQF

Database of Orthologous Groups

More...OrthoDBi		297114at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P11473

TreeFam database of animal gene trees

More...TreeFami		TF316304

Family and domain databases

Conserved Domains Database

More...CDDi		cd06955, NR_DBD_VDR, 1 hit

Database of protein disorder

More...DisProti		DP00184

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.565.10, 1 hit
3.30.50.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR042153, DBD_VDR
IPR035500, NHR-like_dom_sf
IPR000536, Nucl_hrmn_rcpt_lig-bd
IPR001723, Nuclear_hrmn_rcpt
IPR000324, VitD_rcpt
IPR001628, Znf_hrmn_rcpt
IPR013088, Znf_NHR/GATA

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00104, Hormone_recep, 1 hit
PF00105, zf-C4, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00398, STRDHORMONER
PR00047, STROIDFINGER
PR00350, VITAMINDR

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00430, HOLI, 1 hit
SM00399, ZnF_C4, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48508, SSF48508, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51843, NR_LBD, 1 hit
PS00031, NUCLEAR_REC_DBD_1, 1 hit
PS51030, NUCLEAR_REC_DBD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P11473-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEAMAASTSL PDPGDFDRNV PRICGVCGDR ATGFHFNAMT CEGCKGFFRR 
        60         70         80         90        100
SMKRKALFTC PFNGDCRITK DNRRHCQACR LKRCVDIGMM KEFILTDEEV 
       110        120        130        140        150
QRKREMILKR KEEEALKDSL RPKLSEEQQR IIAILLDAHH KTYDPTYSDF 
       160        170        180        190        200
CQFRPPVRVN DGGGSHPSRP NSRHTPSFSG DSSSSCSDHC ITSSDMMDSS 
       210        220        230        240        250
SFSNLDLSEE DSDDPSVTLE LSQLSMLPHL ADLVSYSIQK VIGFAKMIPG 
       260        270        280        290        300
FRDLTSEDQI VLLKSSAIEV IMLRSNESFT MDDMSWTCGN QDYKYRVSDV 
       310        320        330        340        350
TKAGHSLELI EPLIKFQVGL KKLNLHEEEH VLLMAICIVS PDRPGVQDAA 
       360        370        380        390        400
LIEAIQDRLS NTLQTYIRCR HPPPGSHLLY AKMIQKLADL RSLNEEHSKQ 
       410        420 
YRCLSFQPEC SMKLTPLVLE VFGNEIS
Length:427
Mass (Da):48,289
Last modified:October 1, 1989 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF95F300D042C4CB7
GO
Isoform 2 (identifier: P11473-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEWRNKKRSDWLSMVLRTAGVEEAFGSEVSVRPHRRAPLGSTYLPPAPSGM

Show »
Length:477
Mass (Da):53,883
Checksum:i7E4B93646169F6A8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A5K1VW50A0A5K1VW50_HUMAN
1,25-dihydroxyvitamin D3 receptor
VDR
494Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VRJ4F8VRJ4_HUMAN
1,25-dihydroxyvitamin D3 receptor
VDR
250Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VVY8F8VVY8_HUMAN
Vitamin D3 receptor
VDR
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VPF8F8VPF8_HUMAN
Vitamin D3 receptor
VDR
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VXQ9F8VXQ9_HUMAN
Vitamin D3 receptor
VDR
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH60832 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAP88938 differs from that shown. Reason: Erroneous gene model prediction.Curated

<p>This subsection of the 'Sequence' section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement%5Fin%5Fdisease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Genetic variations in VDR may determine Mycobacterium tuberculosis susceptibility [MIMi:607948].1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_00465633G → D in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909790EnsemblClinVar.1
Natural variantiVAR_00465735H → Q in VDDR2A. 1 Publication1
Natural variantiVAR_00465845K → E in VDDR2A. 1 Publication1
Natural variantiVAR_00465946G → D in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909797EnsemblClinVar.1
Natural variantiVAR_00466047F → I in VDDR2A. 1 Publication1
Natural variantiVAR_00466150R → Q in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909794EnsemblClinVar.1
Natural variantiVAR_00466273R → Q in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909791EnsemblClinVar.1
Natural variantiVAR_00466380R → Q in VDDR2A. 2 PublicationsCorresponds to variant dbSNP:rs121909793EnsemblClinVar.1
Natural variantiVAR_079325152 – 427Missing in VDDR2A; loss of calcitriol receptor activity; loss of affinity for calcitriol; no effect on ligand-independent localization to the nucleus. 2 PublicationsCorresponds to variant dbSNP:rs121909795Add BLAST276
Natural variantiVAR_029309230L → V1 PublicationCorresponds to variant dbSNP:rs11574090Ensembl.1
Natural variantiVAR_004664274R → L in VDDR2A; loss of calcitriol receptor activity; decreased affinity for calcitriol by a factor of 1000; no effect on interaction with RXRA; changed interaction with NCOR1; loss of interaction with NCOA1; no effect on sequence-specific DNA-binding. 2 PublicationsCorresponds to variant dbSNP:rs121909796EnsemblClinVar.1
Natural variantiVAR_004665305H → Q in VDDR2A; loss of calcitriol receptor activity; no effect on interaction with RXRA; changed interaction with NCOR1; loss of interaction with NCOA1; no effect on sequence-specific DNA-binding. 2 PublicationsCorresponds to variant dbSNP:rs121909798EnsemblClinVar.1
Natural variantiVAR_004666314I → S in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909799EnsemblClinVar.1
Natural variantiVAR_079326346V → M in VDDR2A; decreased calcitriol receptor activity; decreased affinity for calcitriol; decreased ligand-independent localization to the nucleus; loss of interaction with RXRA; decreased interaction with NCOR1; decreased interaction with NCOA1; decreased sequence-specific DNA-binding. 2 PublicationsCorresponds to variant dbSNP:rs267607169EnsemblClinVar.1
Natural variantiVAR_079327360S → P in VDDR2A; loss of calcitriol receptor activity; loss of affinity for calcitriol; decreased ligand-independent localization to the nucleus; loss of interaction with RXRA; loss of interaction with NCOR1; loss of interaction with NCOA1; loss of sequence-specific DNA-binding. 1 Publication1
Natural variantiVAR_029310362T → I1 PublicationCorresponds to variant dbSNP:rs11574115EnsemblClinVar.1
Natural variantiVAR_004667391R → C in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909800EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0472181M → MEWRNKKRSDWLSMVLRTAG VEEAFGSEVSVRPHRRAPLG STYLPPAPSGM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
J03258 mRNA Translation: AAA61273.1
X67482 mRNA Translation: CAA47824.1
AF026260 mRNA Translation: AAB95155.1
AB002168 Genomic DNA Translation: BAA83389.1
AY342401 Genomic DNA Translation: AAP88938.1 Sequence problems.
AK312267 mRNA Translation: BAG35198.1
AC004466 Genomic DNA No translation available.
AC121338 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW57960.1
CH471111 Genomic DNA Translation: EAW57961.1
BC060832 mRNA Translation: AAH60832.1 Different initiation.
M65208 mRNA Translation: AAA61274.1
AY827087 Genomic DNA Translation: AAV85448.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS55820.1 [P11473-2]
CCDS8757.1 [P11473-1]

Protein sequence database of the Protein Information Resource

More...PIRi		A28200

NCBI Reference Sequences

More...RefSeqi		NP_000367.1, NM_000376.2 [P11473-1]
NP_001017535.1, NM_001017535.1 [P11473-1]
NP_001017536.1, NM_001017536.1 [P11473-2]
XP_006719650.1, XM_006719587.3
XP_011537022.1, XM_011538720.2 [P11473-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000395324; ENSP00000378734; ENSG00000111424 [P11473-1]
ENST00000549336; ENSP00000449573; ENSG00000111424 [P11473-1]
ENST00000550325; ENSP00000447173; ENSG00000111424 [P11473-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7421

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7421

UCSC genome browser

More...UCSCi		uc001rql.4, human [P11473-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs
SHMPD

The Singapore human mutation and polymorphism database

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J03258 mRNA Translation: AAA61273.1
X67482 mRNA Translation: CAA47824.1
AF026260 mRNA Translation: AAB95155.1
AB002168 Genomic DNA Translation: BAA83389.1
AY342401 Genomic DNA Translation: AAP88938.1 Sequence problems.
AK312267 mRNA Translation: BAG35198.1
AC004466 Genomic DNA No translation available.
AC121338 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW57960.1
CH471111 Genomic DNA Translation: EAW57961.1
BC060832 mRNA Translation: AAH60832.1 Different initiation.
M65208 mRNA Translation: AAA61274.1
AY827087 Genomic DNA Translation: AAV85448.1
CCDSiCCDS55820.1 [P11473-2]
CCDS8757.1 [P11473-1]
PIRiA28200
RefSeqiNP_000367.1, NM_000376.2 [P11473-1]
NP_001017535.1, NM_001017535.1 [P11473-1]
NP_001017536.1, NM_001017536.1 [P11473-2]
XP_006719650.1, XM_006719587.3
XP_011537022.1, XM_011538720.2 [P11473-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1DB1X-ray1.80A118-427[»]
1IE8X-ray1.52A118-427[»]
1IE9X-ray1.40A118-427[»]
1KB2X-ray2.70A/B16-125[»]
1KB4X-ray2.80A/B16-125[»]
1KB6X-ray2.70A/B16-125[»]
1S0ZX-ray2.50A118-427[»]
1S19X-ray2.10A118-427[»]
1TXIX-ray1.90A118-427[»]
1YNWX-ray3.00A16-125[»]
2HAMX-ray1.90A118-427[»]
2HARX-ray1.90A118-427[»]
2HASX-ray1.96A118-427[»]
2HB7X-ray1.80A118-427[»]
2HB8X-ray2.00A118-427[»]
3A2IX-ray3.27A118-427[»]
3A2JX-ray2.70A118-427[»]
3A3ZX-ray1.72X118-427[»]
3A40X-ray1.45X118-427[»]
3A78X-ray1.90A118-427[»]
3AUQX-ray2.64A118-427[»]
3AURX-ray2.21A118-427[»]
3AX8X-ray2.60A118-427[»]
3AZ1X-ray1.50A120-423[»]
3AZ2X-ray1.69A120-423[»]
3AZ3X-ray1.36A120-423[»]
3B0TX-ray1.30A120-423[»]
3CS4X-ray2.00A118-427[»]
3CS6X-ray1.80A118-427[»]
3KPZX-ray1.90A118-427[»]
3M7RX-ray1.80A120-423[»]
3OGTX-ray1.75A118-427[»]
3P8XX-ray1.70A118-164[»]
A217-427[»]
3TKCX-ray1.75A118-427[»]
3VHWX-ray2.43A118-427[»]
3W0AX-ray1.80A120-423[»]
3W0CX-ray1.90A120-423[»]
3W0YX-ray1.98A120-423[»]
3WGPX-ray2.00A120-423[»]
3WWRX-ray3.18A118-427[»]
3X31X-ray2.11A118-427[»]
3X36X-ray1.93A118-427[»]
4G2IX-ray1.80A118-427[»]
4ITEX-ray2.49A118-427[»]
4ITFX-ray2.84A118-427[»]
5GT4X-ray1.83A118-423[»]
5V39X-ray2.20A119-425[»]
5YSYX-ray2.00A118-423[»]
5YT2X-ray2.00A118-423[»]
SMRiP11473
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi113264, 103 interactors
ComplexPortaliCPX-631, RXRalpha-VDR nuclear hormone receptor complex
CPX-871, RXRbeta-VDR nuclear hormone receptor complex
CORUMiP11473
DIPiDIP-32624N
ELMiP11473
IntActiP11473, 34 interactors
MINTiP11473
STRINGi9606.ENSP00000447173

Chemistry databases

BindingDBiP11473
ChEMBLiCHEMBL1977
DrugBankiDB07530, (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-trimethyl-3-[6,6,6-trifluoro-5-hydroxy-5-(trifluoromethyl)hex-3-yn-1-yl]cyclopentyl}prop-2-en-1-ylidene]cyclohexane-1,3-diol
DB08742, 1,3-CYCLOHEXANEDIOL, 4-METHYLENE-5-[(2E)-[(1S,3AS,7AS)-OCTAHYDRO-1-(5-HYDROXY-5-METHYL-1,3-HEXADIYNYL)-7A-METHYL-4H-INDEN-4-YLIDENE]ETHYLIDENE]-, (1R,3S,5Z)
DB01436, Alfacalcidol
DB04891, Becocalcidiol
DB00146, Calcifediol
DB02300, Calcipotriol
DB00136, Calcitriol
DB00169, Cholecalciferol
DB04540, Cholesterol
DB05024, CTA018
DB11672, Curcumin
DB14635, Curcumin sulfate
DB01070, Dihydrotachysterol
DB06410, Doxercalciferol
DB05295, Eldecalcitol
DB06194, Elocalcitol
DB00153, Ergocalciferol
DB04796, Inecalcitol
DB03451, Lexacalcitol
DB00910, Paricalcitol
DB04258, Seocalcitol
DB11094, Vitamin D
DrugCentraliP11473
GuidetoPHARMACOLOGYi605
SwissLipidsiSLP:000001571

Protein family/group databases

MoonDBiP11473, Predicted
TCDBi9.B.208.1.1, the vitamin d3 receptor (vdr) family

PTM databases

iPTMnetiP11473
PhosphoSitePlusiP11473

Genetic variation databases

BioMutaiVDR
DMDMi137617

Proteomic databases

EPDiP11473
jPOSTiP11473
MassIVEiP11473
MaxQBiP11473
PaxDbiP11473
PeptideAtlasiP11473
PRIDEiP11473
ProteomicsDBi32456
52780 [P11473-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3902, 775 antibodies

The DNASU plasmid repository

More...DNASUi		7421

Genome annotation databases

EnsembliENST00000395324; ENSP00000378734; ENSG00000111424 [P11473-1]
ENST00000549336; ENSP00000449573; ENSG00000111424 [P11473-1]
ENST00000550325; ENSP00000447173; ENSG00000111424 [P11473-2]
GeneIDi7421
KEGGihsa:7421
UCSCiuc001rql.4, human [P11473-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7421
DisGeNETi7421

GeneCards: human genes, protein and diseases

More...GeneCardsi		VDR
HGNCiHGNC:12679, VDR
HPAiENSG00000111424, Tissue enhanced (intestine, parathyroid gland)
MalaCardsiVDR
MIMi277440, phenotype
601769, gene
607948, phenotype
neXtProtiNX_P11473
OpenTargetsiENSG00000111424
Orphaneti93160, Hypocalcemic vitamin D-resistant rickets
PharmGKBiPA37301
VEuPathDBiHostDB:ENSG00000111424.10

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3575, Eukaryota
GeneTreeiENSGT00940000155473
InParanoidiP11473
OMAiYADFTQF
OrthoDBi297114at2759
PhylomeDBiP11473
TreeFamiTF316304

Enzyme and pathway databases

PathwayCommonsiP11473
ReactomeiR-HSA-196791, Vitamin D (calciferol) metabolism
R-HSA-383280, Nuclear Receptor transcription pathway
R-HSA-4090294, SUMOylation of intracellular receptors
SignaLinkiP11473
SIGNORiP11473

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		7421, 6 hits in 894 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		VDR, human
EvolutionaryTraceiP11473

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Calcitriol_receptor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7421
PharosiP11473, Tclin

Protein Ontology

More...PROi		PR:P11473
RNActiP11473, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000111424, Expressed in tibia and 195 other tissues
ExpressionAtlasiP11473, baseline and differential
GenevisibleiP11473, HS

Family and domain databases

CDDicd06955, NR_DBD_VDR, 1 hit
DisProtiDP00184
Gene3Di1.10.565.10, 1 hit
3.30.50.10, 1 hit
InterProiView protein in InterPro
IPR042153, DBD_VDR
IPR035500, NHR-like_dom_sf
IPR000536, Nucl_hrmn_rcpt_lig-bd
IPR001723, Nuclear_hrmn_rcpt
IPR000324, VitD_rcpt
IPR001628, Znf_hrmn_rcpt
IPR013088, Znf_NHR/GATA
PfamiView protein in Pfam
PF00104, Hormone_recep, 1 hit
PF00105, zf-C4, 1 hit
PRINTSiPR00398, STRDHORMONER
PR00047, STROIDFINGER
PR00350, VITAMINDR
SMARTiView protein in SMART
SM00430, HOLI, 1 hit
SM00399, ZnF_C4, 1 hit
SUPFAMiSSF48508, SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843, NR_LBD, 1 hit
PS00031, NUCLEAR_REC_DBD_1, 1 hit
PS51030, NUCLEAR_REC_DBD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVDR_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P11473
Secondary accession number(s): B2R5Q1, G3V1V9, Q5PSV3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: October 1, 1989
Last modified: February 10, 2021
This is version 242 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again