Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 228 (08 May 2019)
Sequence version 1 (01 Oct 1989)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Vitamin D3 receptor

Gene

VDR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Nuclear receptor for calcitriol, the active form of vitamin D3 which mediates the action of this vitamin on cells (PubMed:28698609, PubMed:16913708, PubMed:15728261, PubMed:10678179). Enters the nucleus upon vitamin D3 binding where it forms heterodimers with the retinoid X receptor/RXR (PubMed:28698609). The VDR-RXR heterodimers bind to specific response elements on DNA and activate the transcription of vitamin D3-responsive target genes (PubMed:28698609). Plays a central role in calcium homeostasis (By similarity).By similarity4 Publications

Caution

It is uncertain whether Met-1 or Met-4 is the initiator.Curated
Was thought to be recruited to promoters via its interaction with BAZ1B/WSTF, but this work has later been retracted.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei143Vitamin D31
Binding sitei305Vitamin D31
Binding sitei397Vitamin D31

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi21 – 96Nuclear receptorPROSITE-ProRule annotationAdd BLAST76
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri24 – 44NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri60 – 84NR C4-typePROSITE-ProRule annotationAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Receptor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-196791 Vitamin D (calciferol) metabolism
R-HSA-383280 Nuclear Receptor transcription pathway
R-HSA-4090294 SUMOylation of intracellular receptors

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P11473

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P11473

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
P11473 Predicted

Transport Classification Database

More...
TCDBi
9.B.208.1.1 the vitamin d3 receptor (vdr) family

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000001571

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Vitamin D3 receptor
Short name:
VDR
Alternative name(s):
1,25-dihydroxyvitamin D3 receptor
Nuclear receptor subfamily 1 group I member 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:VDR
Synonyms:NR1I1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12679 VDR

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601769 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P11473

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Rickets vitamin D-dependent 2A (VDDR2A)12 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder of vitamin D metabolism resulting in severe rickets, hypocalcemia and secondary hyperparathyroidism. Most patients have total alopecia in addition to rickets.
See also OMIM:277440
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_00465633G → D in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909790EnsemblClinVar.1
Natural variantiVAR_00465735H → Q in VDDR2A. 1 Publication1
Natural variantiVAR_00465845K → E in VDDR2A. 1 Publication1
Natural variantiVAR_00465946G → D in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909797EnsemblClinVar.1
Natural variantiVAR_00466047F → I in VDDR2A. 1 Publication1
Natural variantiVAR_00466150R → Q in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909794EnsemblClinVar.1
Natural variantiVAR_00466273R → Q in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909791EnsemblClinVar.1
Natural variantiVAR_00466380R → Q in VDDR2A. 2 PublicationsCorresponds to variant dbSNP:rs121909793EnsemblClinVar.1
Natural variantiVAR_079325152 – 427Missing in VDDR2A; loss of calcitriol receptor activity; loss of affinity for calcitriol; no effect on ligand-independent localization to the nucleus. 2 PublicationsCorresponds to variant dbSNP:rs121909795Add BLAST276
Natural variantiVAR_004664274R → L in VDDR2A; loss of calcitriol receptor activity; decreased affinity for calcitriol by a factor of 1000; no effect on interaction with RXRA; changed interaction with NCOR1; loss of interaction with NCOA1; no effect on sequence-specific DNA-binding. 2 PublicationsCorresponds to variant dbSNP:rs121909796EnsemblClinVar.1
Natural variantiVAR_004665305H → Q in VDDR2A; loss of calcitriol receptor activity; no effect on interaction with RXRA; changed interaction with NCOR1; loss of interaction with NCOA1; no effect on sequence-specific DNA-binding. 2 PublicationsCorresponds to variant dbSNP:rs121909798EnsemblClinVar.1
Natural variantiVAR_004666314I → S in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909799EnsemblClinVar.1
Natural variantiVAR_079326346V → M in VDDR2A; decreased calcitriol receptor activity; decreased affinity for calcitriol; decreased ligand-independent localization to the nucleus; loss of interaction with RXRA; decreased interaction with NCOR1; decreased interaction with NCOA1; decreased sequence-specific DNA-binding. 2 PublicationsCorresponds to variant dbSNP:rs267607169EnsemblClinVar.1
Natural variantiVAR_079327360S → P in VDDR2A; loss of calcitriol receptor activity; loss of affinity for calcitriol; decreased ligand-independent localization to the nucleus; loss of interaction with RXRA; loss of interaction with NCOR1; loss of interaction with NCOA1; loss of sequence-specific DNA-binding. 1 Publication1
Natural variantiVAR_004667391R → C in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909800EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi61 – 62PF → AA: Promotes heterodimerization with RXRA; when associated with A-75. 1 Publication2
Mutagenesisi75H → A: Promotes heterodimerization with RXRA; when associated with A-61 and A-62. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
7421

MalaCards human disease database

More...
MalaCardsi
VDR
MIMi277440 phenotype
607948 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000111424

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
93160 Hypocalcemic vitamin D-resistant rickets

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37301

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1977

Drug and drug target database

More...
DrugBanki
DB01436 Alfacalcidol
DB00146 Calcidiol
DB02300 Calcipotriol
DB00136 Calcitriol
DB00169 Cholecalciferol
DB05024 CTA018
DB01070 Dihydrotachysterol
DB06410 Doxercalciferol
DB05295 Eldecalcitol
DB00153 Ergocalciferol
DB04796 Inecalcitol
DB00910 Paricalcitol
DB04258 Seocalcitol

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
605

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
VDR

Domain mapping of disease mutations (DMDM)

More...
DMDMi
137617

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000535421 – 427Vitamin D3 receptorAdd BLAST427

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P11473

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P11473

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P11473

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P11473

PeptideAtlas

More...
PeptideAtlasi
P11473

PRoteomics IDEntifications database

More...
PRIDEi
P11473

ProteomicsDB human proteome resource

More...
ProteomicsDBi
52780

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P11473

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P11473

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000111424 Expressed in 187 organ(s), highest expression level in tibia

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P11473 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P11473 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB004617
HPA047740

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer in the absence of bound vitamin D3 (PubMed:11980721). Heterodimer with RXRA after vitamin D3 binding (PubMed:15225774, PubMed:11980721, PubMed:10678179). Interacts with MED1, NCOA1, NCOA2, NCOA3 and NCOA6 coactivators, leading to a strong increase of transcription of target genes (PubMed:10866662, PubMed:15728261, PubMed:28698609, PubMed:9267036). Interacts with the corepressor NCOR1 (PubMed:28698609). Interacts with SNW1 (PubMed:9632709). Interacts with IRX4, the interaction does not affect its transactivation activity (PubMed:22323358). Interacts with CRY1 (By similarity). Interacts with CRY2 in a ligand-dependent manner (By similarity).By similarity9 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
113264, 99 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-631 RXRalpha-VDR nuclear hormone receptor complex
CPX-871 RXRbeta-VDR nuclear hormone receptor complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P11473

Database of interacting proteins

More...
DIPi
DIP-32624N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P11473

Protein interaction database and analysis system

More...
IntActi
P11473, 32 interactors

Molecular INTeraction database

More...
MINTi
P11473

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000447173

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P11473

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1427
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1DB1X-ray1.80A118-427[»]
1IE8X-ray1.52A118-427[»]
1IE9X-ray1.40A118-427[»]
1KB2X-ray2.70A/B16-125[»]
1KB4X-ray2.80A/B16-125[»]
1KB6X-ray2.70A/B16-125[»]
1S0ZX-ray2.50A118-427[»]
1S19X-ray2.10A118-427[»]
1TXIX-ray1.90A118-427[»]
1YNWX-ray3.00A16-125[»]
2HAMX-ray1.90A118-427[»]
2HARX-ray1.90A118-427[»]
2HASX-ray1.96A118-427[»]
2HB7X-ray1.80A118-427[»]
2HB8X-ray2.00A118-427[»]
3A2IX-ray3.27A118-427[»]
3A2JX-ray2.70A118-427[»]
3A3ZX-ray1.72X118-427[»]
3A40X-ray1.45X118-427[»]
3A78X-ray1.90A118-427[»]
3AUQX-ray2.64A118-427[»]
3AURX-ray2.21A118-427[»]
3AX8X-ray2.60A118-427[»]
3AZ1X-ray1.50A120-423[»]
3AZ2X-ray1.69A120-423[»]
3AZ3X-ray1.36A120-423[»]
3B0TX-ray1.30A120-423[»]
3CS4X-ray2.00A118-427[»]
3CS6X-ray1.80A118-427[»]
3KPZX-ray1.90A118-427[»]
3M7RX-ray1.80A120-423[»]
3OGTX-ray1.75A118-427[»]
3P8XX-ray1.70A118-164[»]
A217-427[»]
3TKCX-ray1.75A118-427[»]
3VHWX-ray2.43A118-427[»]
3W0AX-ray1.80A120-423[»]
3W0CX-ray1.90A120-423[»]
3W0YX-ray1.98A120-423[»]
3WGPX-ray2.00A120-423[»]
3WWRX-ray3.18A118-427[»]
3X31X-ray2.11A118-427[»]
3X36X-ray1.93A118-427[»]
4G2IX-ray1.80A118-427[»]
4ITEX-ray2.49A118-427[»]
4ITFX-ray2.84A118-427[»]
5GT4X-ray1.83A118-423[»]
5V39X-ray2.20A119-425[»]
5YSYX-ray2.00A118-423[»]
5YT2X-ray2.00A118-423[»]

Database of protein disorder

More...
DisProti
DP00184

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P11473

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P11473

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini127 – 423NR LBDPROSITE-ProRule annotationAdd BLAST297

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni97 – 126HingeAdd BLAST30
Regioni227 – 237Vitamin D3 bindingAdd BLAST11
Regioni271 – 278Vitamin D3 binding8

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi416 – 4249aaTAD1 Publication9

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.
The 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri24 – 44NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri60 – 84NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3575 Eukaryota
ENOG410XRZC LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155473

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000220844

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P11473

KEGG Orthology (KO)

More...
KOi
K08539

Identification of Orthologs from Complete Genome Data

More...
OMAi
FTQFRPP

Database of Orthologous Groups

More...
OrthoDBi
1517597at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P11473

TreeFam database of animal gene trees

More...
TreeFami
TF316304

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.565.10, 1 hit
3.30.50.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035500 NHR-like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR000324 VitD_rcpt
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00398 STRDHORMONER
PR00047 STROIDFINGER
PR00350 VITAMINDR

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48508 SSF48508, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P11473-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEAMAASTSL PDPGDFDRNV PRICGVCGDR ATGFHFNAMT CEGCKGFFRR
60 70 80 90 100
SMKRKALFTC PFNGDCRITK DNRRHCQACR LKRCVDIGMM KEFILTDEEV
110 120 130 140 150
QRKREMILKR KEEEALKDSL RPKLSEEQQR IIAILLDAHH KTYDPTYSDF
160 170 180 190 200
CQFRPPVRVN DGGGSHPSRP NSRHTPSFSG DSSSSCSDHC ITSSDMMDSS
210 220 230 240 250
SFSNLDLSEE DSDDPSVTLE LSQLSMLPHL ADLVSYSIQK VIGFAKMIPG
260 270 280 290 300
FRDLTSEDQI VLLKSSAIEV IMLRSNESFT MDDMSWTCGN QDYKYRVSDV
310 320 330 340 350
TKAGHSLELI EPLIKFQVGL KKLNLHEEEH VLLMAICIVS PDRPGVQDAA
360 370 380 390 400
LIEAIQDRLS NTLQTYIRCR HPPPGSHLLY AKMIQKLADL RSLNEEHSKQ
410 420
YRCLSFQPEC SMKLTPLVLE VFGNEIS
Length:427
Mass (Da):48,289
Last modified:October 1, 1989 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF95F300D042C4CB7
GO
Isoform 2 (identifier: P11473-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEWRNKKRSDWLSMVLRTAGVEEAFGSEVSVRPHRRAPLGSTYLPPAPSGM

Note: No experimental confirmation available.
Show »
Length:477
Mass (Da):53,883
Checksum:i7E4B93646169F6A8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VRJ4F8VRJ4_HUMAN
Vitamin D3 receptor
VDR
250Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VPF8F8VPF8_HUMAN
Vitamin D3 receptor
VDR
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VVY8F8VVY8_HUMAN
Vitamin D3 receptor
VDR
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VXQ9F8VXQ9_HUMAN
Vitamin D3 receptor
VDR
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH60832 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAP88938 differs from that shown. Reason: Erroneous gene model prediction.Curated

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Genetic variations in VDR may determine Mycobacterium tuberculosis susceptibility [MIMi:607948].1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_00465633G → D in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909790EnsemblClinVar.1
Natural variantiVAR_00465735H → Q in VDDR2A. 1 Publication1
Natural variantiVAR_00465845K → E in VDDR2A. 1 Publication1
Natural variantiVAR_00465946G → D in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909797EnsemblClinVar.1
Natural variantiVAR_00466047F → I in VDDR2A. 1 Publication1
Natural variantiVAR_00466150R → Q in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909794EnsemblClinVar.1
Natural variantiVAR_00466273R → Q in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909791EnsemblClinVar.1
Natural variantiVAR_00466380R → Q in VDDR2A. 2 PublicationsCorresponds to variant dbSNP:rs121909793EnsemblClinVar.1
Natural variantiVAR_079325152 – 427Missing in VDDR2A; loss of calcitriol receptor activity; loss of affinity for calcitriol; no effect on ligand-independent localization to the nucleus. 2 PublicationsCorresponds to variant dbSNP:rs121909795Add BLAST276
Natural variantiVAR_029309230L → V1 PublicationCorresponds to variant dbSNP:rs11574090Ensembl.1
Natural variantiVAR_004664274R → L in VDDR2A; loss of calcitriol receptor activity; decreased affinity for calcitriol by a factor of 1000; no effect on interaction with RXRA; changed interaction with NCOR1; loss of interaction with NCOA1; no effect on sequence-specific DNA-binding. 2 PublicationsCorresponds to variant dbSNP:rs121909796EnsemblClinVar.1
Natural variantiVAR_004665305H → Q in VDDR2A; loss of calcitriol receptor activity; no effect on interaction with RXRA; changed interaction with NCOR1; loss of interaction with NCOA1; no effect on sequence-specific DNA-binding. 2 PublicationsCorresponds to variant dbSNP:rs121909798EnsemblClinVar.1
Natural variantiVAR_004666314I → S in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909799EnsemblClinVar.1
Natural variantiVAR_079326346V → M in VDDR2A; decreased calcitriol receptor activity; decreased affinity for calcitriol; decreased ligand-independent localization to the nucleus; loss of interaction with RXRA; decreased interaction with NCOR1; decreased interaction with NCOA1; decreased sequence-specific DNA-binding. 2 PublicationsCorresponds to variant dbSNP:rs267607169EnsemblClinVar.1
Natural variantiVAR_079327360S → P in VDDR2A; loss of calcitriol receptor activity; loss of affinity for calcitriol; decreased ligand-independent localization to the nucleus; loss of interaction with RXRA; loss of interaction with NCOR1; loss of interaction with NCOA1; loss of sequence-specific DNA-binding. 1 Publication1
Natural variantiVAR_029310362T → I1 PublicationCorresponds to variant dbSNP:rs11574115Ensembl.1
Natural variantiVAR_004667391R → C in VDDR2A. 1 PublicationCorresponds to variant dbSNP:rs121909800EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0472181M → MEWRNKKRSDWLSMVLRTAG VEEAFGSEVSVRPHRRAPLG STYLPPAPSGM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
J03258 mRNA Translation: AAA61273.1
X67482 mRNA Translation: CAA47824.1
AF026260 mRNA Translation: AAB95155.1
AB002168 Genomic DNA Translation: BAA83389.1
AY342401 Genomic DNA Translation: AAP88938.1 Sequence problems.
AK312267 mRNA Translation: BAG35198.1
AC004466 Genomic DNA No translation available.
AC121338 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW57960.1
CH471111 Genomic DNA Translation: EAW57961.1
BC060832 mRNA Translation: AAH60832.1 Different initiation.
M65208 mRNA Translation: AAA61274.1
AY827087 Genomic DNA Translation: AAV85448.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS55820.1 [P11473-2]
CCDS8757.1 [P11473-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
A28200

NCBI Reference Sequences

More...
RefSeqi
NP_000367.1, NM_000376.2 [P11473-1]
NP_001017535.1, NM_001017535.1 [P11473-1]
NP_001017536.1, NM_001017536.1 [P11473-2]
XP_006719650.1, XM_006719587.3 [P11473-1]
XP_011537022.1, XM_011538720.2 [P11473-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000229022; ENSP00000229022; ENSG00000111424 [P11473-1]
ENST00000395324; ENSP00000378734; ENSG00000111424 [P11473-1]
ENST00000549336; ENSP00000449573; ENSG00000111424 [P11473-1]
ENST00000550325; ENSP00000447173; ENSG00000111424 [P11473-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7421

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7421

UCSC genome browser

More...
UCSCi
uc001rql.4 human [P11473-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs
SHMPD

The Singapore human mutation and polymorphism database

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J03258 mRNA Translation: AAA61273.1
X67482 mRNA Translation: CAA47824.1
AF026260 mRNA Translation: AAB95155.1
AB002168 Genomic DNA Translation: BAA83389.1
AY342401 Genomic DNA Translation: AAP88938.1 Sequence problems.
AK312267 mRNA Translation: BAG35198.1
AC004466 Genomic DNA No translation available.
AC121338 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW57960.1
CH471111 Genomic DNA Translation: EAW57961.1
BC060832 mRNA Translation: AAH60832.1 Different initiation.
M65208 mRNA Translation: AAA61274.1
AY827087 Genomic DNA Translation: AAV85448.1
CCDSiCCDS55820.1 [P11473-2]
CCDS8757.1 [P11473-1]
PIRiA28200
RefSeqiNP_000367.1, NM_000376.2 [P11473-1]
NP_001017535.1, NM_001017535.1 [P11473-1]
NP_001017536.1, NM_001017536.1 [P11473-2]
XP_006719650.1, XM_006719587.3 [P11473-1]
XP_011537022.1, XM_011538720.2 [P11473-1]

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1DB1X-ray1.80A118-427[»]
1IE8X-ray1.52A118-427[»]
1IE9X-ray1.40A118-427[»]
1KB2X-ray2.70A/B16-125[»]
1KB4X-ray2.80A/B16-125[»]
1KB6X-ray2.70A/B16-125[»]
1S0ZX-ray2.50A118-427[»]
1S19X-ray2.10A118-427[»]
1TXIX-ray1.90A118-427[»]
1YNWX-ray3.00A16-125[»]
2HAMX-ray1.90A118-427[»]
2HARX-ray1.90A118-427[»]
2HASX-ray1.96A118-427[»]
2HB7X-ray1.80A118-427[»]
2HB8X-ray2.00A118-427[»]
3A2IX-ray3.27A118-427[»]
3A2JX-ray2.70A118-427[»]
3A3ZX-ray1.72X118-427[»]
3A40X-ray1.45X118-427[»]
3A78X-ray1.90A118-427[»]
3AUQX-ray2.64A118-427[»]
3AURX-ray2.21A118-427[»]
3AX8X-ray2.60A118-427[»]
3AZ1X-ray1.50A120-423[»]
3AZ2X-ray1.69A120-423[»]
3AZ3X-ray1.36A120-423[»]
3B0TX-ray1.30A120-423[»]
3CS4X-ray2.00A118-427[»]
3CS6X-ray1.80A118-427[»]
3KPZX-ray1.90A118-427[»]
3M7RX-ray1.80A120-423[»]
3OGTX-ray1.75A118-427[»]
3P8XX-ray1.70A118-164[»]
A217-427[»]
3TKCX-ray1.75A118-427[»]
3VHWX-ray2.43A118-427[»]
3W0AX-ray1.80A120-423[»]
3W0CX-ray1.90A120-423[»]
3W0YX-ray1.98A120-423[»]
3WGPX-ray2.00A120-423[»]
3WWRX-ray3.18A118-427[»]
3X31X-ray2.11A118-427[»]
3X36X-ray1.93A118-427[»]
4G2IX-ray1.80A118-427[»]
4ITEX-ray2.49A118-427[»]
4ITFX-ray2.84A118-427[»]
5GT4X-ray1.83A118-423[»]
5V39X-ray2.20A119-425[»]
5YSYX-ray2.00A118-423[»]
5YT2X-ray2.00A118-423[»]
DisProtiDP00184
SMRiP11473
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113264, 99 interactors
ComplexPortaliCPX-631 RXRalpha-VDR nuclear hormone receptor complex
CPX-871 RXRbeta-VDR nuclear hormone receptor complex
CORUMiP11473
DIPiDIP-32624N
ELMiP11473
IntActiP11473, 32 interactors
MINTiP11473
STRINGi9606.ENSP00000447173

Chemistry databases

BindingDBiP11473
ChEMBLiCHEMBL1977
DrugBankiDB01436 Alfacalcidol
DB00146 Calcidiol
DB02300 Calcipotriol
DB00136 Calcitriol
DB00169 Cholecalciferol
DB05024 CTA018
DB01070 Dihydrotachysterol
DB06410 Doxercalciferol
DB05295 Eldecalcitol
DB00153 Ergocalciferol
DB04796 Inecalcitol
DB00910 Paricalcitol
DB04258 Seocalcitol
GuidetoPHARMACOLOGYi605
SwissLipidsiSLP:000001571

Protein family/group databases

MoonDBiP11473 Predicted
TCDBi9.B.208.1.1 the vitamin d3 receptor (vdr) family

PTM databases

iPTMnetiP11473
PhosphoSitePlusiP11473

Polymorphism and mutation databases

BioMutaiVDR
DMDMi137617

Proteomic databases

EPDiP11473
jPOSTiP11473
MaxQBiP11473
PaxDbiP11473
PeptideAtlasiP11473
PRIDEiP11473
ProteomicsDBi52780

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
7421
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000229022; ENSP00000229022; ENSG00000111424 [P11473-1]
ENST00000395324; ENSP00000378734; ENSG00000111424 [P11473-1]
ENST00000549336; ENSP00000449573; ENSG00000111424 [P11473-1]
ENST00000550325; ENSP00000447173; ENSG00000111424 [P11473-2]
GeneIDi7421
KEGGihsa:7421
UCSCiuc001rql.4 human [P11473-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7421
DisGeNETi7421

GeneCards: human genes, protein and diseases

More...
GeneCardsi
VDR
HGNCiHGNC:12679 VDR
HPAiCAB004617
HPA047740
MalaCardsiVDR
MIMi277440 phenotype
601769 gene
607948 phenotype
neXtProtiNX_P11473
OpenTargetsiENSG00000111424
Orphaneti93160 Hypocalcemic vitamin D-resistant rickets
PharmGKBiPA37301

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3575 Eukaryota
ENOG410XRZC LUCA
GeneTreeiENSGT00940000155473
HOGENOMiHOG000220844
InParanoidiP11473
KOiK08539
OMAiFTQFRPP
OrthoDBi1517597at2759
PhylomeDBiP11473
TreeFamiTF316304

Enzyme and pathway databases

ReactomeiR-HSA-196791 Vitamin D (calciferol) metabolism
R-HSA-383280 Nuclear Receptor transcription pathway
R-HSA-4090294 SUMOylation of intracellular receptors
SignaLinkiP11473
SIGNORiP11473

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
VDR human
EvolutionaryTraceiP11473

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Calcitriol_receptor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7421

Protein Ontology

More...
PROi
PR:P11473

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000111424 Expressed in 187 organ(s), highest expression level in tibia
ExpressionAtlasiP11473 baseline and differential
GenevisibleiP11473 HS

Family and domain databases

Gene3Di1.10.565.10, 1 hit
3.30.50.10, 1 hit
InterProiView protein in InterPro
IPR035500 NHR-like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR000324 VitD_rcpt
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA
PfamiView protein in Pfam
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit
PRINTSiPR00398 STRDHORMONER
PR00047 STROIDFINGER
PR00350 VITAMINDR
SMARTiView protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit
SUPFAMiSSF48508 SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVDR_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P11473
Secondary accession number(s): B2R5Q1, G3V1V9, Q5PSV3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: October 1, 1989
Last modified: May 8, 2019
This is version 228 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again