UniProtKB - P10972 (RL24_HALMA)

BLAST

>sp|P10972|RL24_HALMA 50S ribosomal protein L24 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) OX=272569 GN=rpl24 PE=1 SV=3
MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEE
GEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA

Align
Format
Add to basket Added to basket
History
Entry version 139 (10 Oct 2018)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

50S ribosomal protein L24

Gene

rpl24

Organism

Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit.By similarity

Stabilizes the tertiary rRNA structure within the 23S rRNA domain (domain I) to which it binds. Located at the polypeptide exit tunnel on the outside of the subunit.

GO - Molecular functionⁱ

rRNA binding Source: UniProtKB-UniRule
structural constituent of ribosome Source: InterPro

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

translation Source: UniProtKB-UniRule

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Molecular function

Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: 50S ribosomal protein L24 Alternative name(s): Hl15 Hl16 Hmal24
Gene namesⁱ	Name:rpl24 Ordered Locus Names:rrnAC1601
Organismⁱ	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)
Taxonomic identifierⁱ	272569 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Archaea › Euryarchaeota › Stenosarchaea group › Halobacteria › Halobacteriales › Haloarculaceae › Haloarcula › Haloarcula marismortui
Proteomesⁱ	UP000001169 Componentⁱ: Chromosome I

Subcellular locationⁱ

GO - Cellular componentⁱ

large ribosomal subunit Source: InterPro

View the complete GO annotation on QuickGO ...

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		Removed2 Publications
ChainⁱPRO_0000130767	2 – 120	50S ribosomal protein L24Add BLAST		119

Interactionⁱ

Subunit structureⁱ

Part of the 50S ribosomal subunit. Interacts weakly with protein L4.2 Publications

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1601

STRINGⁱ

272569.rrnAC1601

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	5 – 13	Combined sources	9
Helixⁱ	17 – 19	Combined sources	3
Helixⁱ	21 – 24	Combined sources	4
Beta strandⁱ	25 – 28	Combined sources	4
Helixⁱ	30 – 36	Combined sources	7
Beta strandⁱ	39 – 42	Combined sources	4
Beta strandⁱ	48 – 51	Combined sources	4
Turnⁱ	55 – 58	Combined sources	4
Beta strandⁱ	60 – 67	Combined sources	8
Turnⁱ	68 – 71	Combined sources	4
Beta strandⁱ	72 – 75	Combined sources	4
Beta strandⁱ	79 – 81	Combined sources	3
Beta strandⁱ	83 – 85	Combined sources	3
Beta strandⁱ	87 – 89	Combined sources	3
Helixⁱ	94 – 96	Combined sources	3
Beta strandⁱ	97 – 101	Combined sources	5
Helixⁱ	107 – 114	Combined sources	8
Beta strandⁱ	116 – 118	Combined sources	3

Show more details

3D structure databases

ProteinModelPortalⁱ	P10972
SMRⁱ	P10972
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P10972

EvolutionaryTraceⁱ

P10972

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the universal ribosomal protein uL24 family.Curated

Phylogenomic databases

eggNOGⁱ	arCOG04094 Archaea COG0198 LUCA
HOGENOMⁱ	HOG000216571
KEGG Orthology (KO) More...KOⁱ	K02895
OMAⁱ	VRIMRGD
Database of Orthologous Groups More...OrthoDBⁱ	POG093Z0H7W

Family and domain databases

Gene3Dⁱ	2.30.30.30, 1 hit
HAMAPⁱ	MF_01326_A Ribosomal_L24_A, 1 hit
InterProⁱ	View protein in InterPro IPR005824 KOW IPR014722 Rib_L2_dom2 IPR005825 Ribosomal_L24/26_CS IPR005756 Ribosomal_L26/L24P_euk/arc IPR008991 Translation_prot_SH3-like_sf
PANTHERⁱ	PTHR11143 PTHR11143, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00467 KOW, 1 hit PF16906 Ribosomal_L26, 1 hit
SMARTⁱ	View protein in SMART SM00739 KOW, 1 hit
SUPFAMⁱ	SSF50104 SSF50104, 1 hit
TIGRFAMsⁱ	TIGR01080 rplX_A_E, 1 hit
PROSITEⁱ	View protein in PROSITE PS01108 RIBOSOMAL_L24, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P10972-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MSKQPDKQRK SQRRAPLHER HKQVRATLSA DLREEYGQRN VRVNAGDTVE 
        60         70         80         90        100
VLRGDFAGEE GEVINVDLDK AVIHVEDVTL EKTDGEEVPR PLDTSNVRVT 
       110        120
DLDLEDEKRE ARLESEDDSA

Length:120

Mass (Da):13,648

Last modified:January 23, 2007 - v3

Checksum:ⁱBDEEF21DE1587096

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	21	H → R AA sequence (PubMed:3191994).Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X55311 Genomic DNA Translation: CAA39019.1 AY596297 Genomic DNA Translation: AAV46518.1
PIRⁱ	S10735 R5HS24
NCBI Reference Sequences More...RefSeqⁱ	WP_004957398.1, NC_006396.1

Genome annotation databases

EnsemblBacteriaⁱ	AAV46518; AAV46518; rrnAC1601
GeneIDⁱ	3128440
KEGGⁱ	hma:rrnAC1601
PATRICⁱ	fig\|272569.17.peg.2290

Protein	Similar proteins		Species	Score	Length	Source
P10972	50S ribosomal protein L24		Haloarcula sinaiiensis ATCC 33800		120	UniRef100_P10972
50S ribosomal protein L24		Haloarcula californiae ATCC 33799		120
UPI0000050FA1		ECOLX		119

Protein	Similar proteins		Species	Score	Length	Source
P10972	50S ribosomal protein L24		Haloarcula sinaiiensis ATCC 33800		120	UniRef90_P10972
50S ribosomal protein L24		Haloarcula californiae ATCC 33799		120
50S ribosomal protein L24		Haloarcula amylolytica JCM 13557		120
50S ribosomal protein L24		HALHT		120
50S ribosomal protein L24		Haloarcula hispanica N601		120
+10

Protein	Similar proteins		Species	Score	Length	Source
P10972	50S ribosomal protein L24		HALSA		118	UniRef50_P10972
50S ribosomal protein L24		HALWD		119
50S ribosomal protein L24		NATPD		120
50S ribosomal protein L24		Haloarcula sinaiiensis ATCC 33800		120
50S ribosomal protein L24		Haloarcula californiae ATCC 33799		120
+268

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X55311 Genomic DNA Translation: CAA39019.1 AY596297 Genomic DNA Translation: AAV46518.1
PIRⁱ	S10735 R5HS24
RefSeqⁱ	WP_004957398.1, NC_006396.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1FFK	X-ray	2.40	Q	2-120	[»]
	1JJ2	X-ray	2.40	S	2-120	[»]
	1K73	X-ray	3.01	U	2-120	[»]
	1K8A	X-ray	3.00	U	2-120	[»]
	1K9M	X-ray	3.00	U	2-120	[»]
	1KC8	X-ray	3.01	U	2-120	[»]
	1KD1	X-ray	3.00	U	2-120	[»]
	1KQS	X-ray	3.10	S	2-120	[»]
	1M1K	X-ray	3.20	U	2-120	[»]
	1M90	X-ray	2.80	U	2-120	[»]
	1N8R	X-ray	3.00	U	2-120	[»]
	1NJI	X-ray	3.00	U	2-120	[»]
	1Q7Y	X-ray	3.20	U	2-120	[»]
	1Q81	X-ray	2.95	U	2-120	[»]
	1Q82	X-ray	2.98	U	2-120	[»]
	1Q86	X-ray	3.00	U	2-120	[»]
	1QVF	X-ray	3.10	S	2-120	[»]
	1QVG	X-ray	2.90	S	2-120	[»]
	1S72	X-ray	2.40	T	1-120	[»]
	1VQ4	X-ray	2.70	T	1-120	[»]
	1VQ5	X-ray	2.60	T	1-120	[»]
	1VQ6	X-ray	2.70	T	1-120	[»]
	1VQ7	X-ray	2.50	T	1-120	[»]
	1VQ8	X-ray	2.20	T	1-120	[»]
	1VQ9	X-ray	2.40	T	1-120	[»]
	1VQK	X-ray	2.30	T	1-120	[»]
	1VQL	X-ray	2.30	T	1-120	[»]
	1VQM	X-ray	2.30	T	1-120	[»]
	1VQN	X-ray	2.40	T	1-120	[»]
	1VQO	X-ray	2.20	T	1-120	[»]
	1VQP	X-ray	2.25	T	1-120	[»]
	1W2B	X-ray	3.50	S	2-120	[»]
	1YHQ	X-ray	2.40	T	1-120	[»]
	1YI2	X-ray	2.65	T	1-120	[»]
	1YIJ	X-ray	2.60	T	1-120	[»]
	1YIT	X-ray	2.80	T	1-120	[»]
	1YJ9	X-ray	2.90	T	1-120	[»]
	1YJN	X-ray	3.00	T	1-120	[»]
	1YJW	X-ray	2.90	T	1-120	[»]
	2OTJ	X-ray	2.90	T	1-120	[»]
	2OTL	X-ray	2.70	T	1-120	[»]
	2QA4	X-ray	3.00	T	1-120	[»]
	2QEX	X-ray	2.90	T	1-120	[»]
	3CC2	X-ray	2.40	T	1-120	[»]
	3CC4	X-ray	2.70	T	1-120	[»]
	3CC7	X-ray	2.70	T	1-120	[»]
	3CCE	X-ray	2.75	T	1-120	[»]
	3CCJ	X-ray	2.70	T	1-120	[»]
	3CCL	X-ray	2.90	T	1-120	[»]
	3CCM	X-ray	2.55	T	1-120	[»]
	3CCQ	X-ray	2.90	T	1-120	[»]
	3CCR	X-ray	3.00	T	1-120	[»]
	3CCS	X-ray	2.95	T	1-120	[»]
	3CCU	X-ray	2.80	T	1-120	[»]
	3CCV	X-ray	2.90	T	1-120	[»]
	3CD6	X-ray	2.75	T	1-120	[»]
	3CMA	X-ray	2.80	T	1-120	[»]
	3CME	X-ray	2.95	T	1-120	[»]
	3CPW	X-ray	2.70	S	1-120	[»]
	3CXC	X-ray	3.00	S	2-120	[»]
	3G4S	X-ray	3.20	T	2-120	[»]
	3G6E	X-ray	2.70	T	2-120	[»]
	3G71	X-ray	2.85	T	2-120	[»]
3I55	X-ray	3.11	T	1-120	[»]
3I56	X-ray	2.90	T	1-120	[»]
3OW2	X-ray	2.70	S	2-120	[»]
4ADX	electron microscopy	6.60	T	1-120	[»]
4V4R	X-ray	5.90	Y	2-120	[»]
4V4T	X-ray	6.46	Y	2-120	[»]
4V9F	X-ray	2.40	T	1-120	[»]
ProteinModelPortalⁱ	P10972
SMRⁱ	P10972
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1601

STRINGⁱ

272569.rrnAC1601

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAV46518; AAV46518; rrnAC1601
GeneIDⁱ	3128440
KEGGⁱ	hma:rrnAC1601
PATRICⁱ	fig\|272569.17.peg.2290

Phylogenomic databases

eggNOGⁱ	arCOG04094 Archaea COG0198 LUCA
HOGENOMⁱ	HOG000216571
KOⁱ	K02895
OMAⁱ	VRIMRGD
OrthoDBⁱ	POG093Z0H7W

Miscellaneous databases

EvolutionaryTraceⁱ	P10972

EvolutionaryTraceⁱ

P10972

Family and domain databases

Gene3Dⁱ	2.30.30.30, 1 hit
HAMAPⁱ	MF_01326_A Ribosomal_L24_A, 1 hit
InterProⁱ	View protein in InterPro IPR005824 KOW IPR014722 Rib_L2_dom2 IPR005825 Ribosomal_L24/26_CS IPR005756 Ribosomal_L26/L24P_euk/arc IPR008991 Translation_prot_SH3-like_sf
PANTHERⁱ	PTHR11143 PTHR11143, 1 hit
Pfamⁱ	View protein in Pfam PF00467 KOW, 1 hit PF16906 Ribosomal_L26, 1 hit
SMARTⁱ	View protein in SMART SM00739 KOW, 1 hit
SUPFAMⁱ	SSF50104 SSF50104, 1 hit
TIGRFAMsⁱ	TIGR01080 rplX_A_E, 1 hit
PROSITEⁱ	View protein in PROSITE PS01108 RIBOSOMAL_L24, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RL24_HALMA
Accessionⁱ	P10972Primary (citable) accession number: P10972 Secondary accession number(s): Q5V1T4
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 1, 1989
	Last sequence update:	January 23, 2007
	Last modified:	October 10, 2018
	This is version 139 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P10972 (RL24_HALMA)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

50S ribosomal protein L24

rpl24

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protocols and materials databases

Genome annotation databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ