UniProtKB - P10970 (RL22_HALMA)

BLAST

>sp|P10970|RL22_HALMA 50S ribosomal protein L22 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) OX=272569 GN=rpl22 PE=1 SV=2
MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPF
KQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKV
GEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED

Align
Format
Add to basket Added to basket
History
Entry version 134 (10 Oct 2018)
Sequence version 2 (23 Jan 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

50S ribosomal protein L22

Gene

rpl22

Organism

Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

This protein binds specifically to 23S rRNA. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome.UniRule annotation

Contacts all 6 domains of the 23S rRNA, helping stabilize their relative orientation. An extended beta-hairpin in the C-terminus forms part of the polypeptide exit tunnel, in which it helps forms a bend with protein L4, while most of the rest of the protein is located at the polypeptide exit tunnel on the outside of the subunit.

GO - Molecular functionⁱ

rRNA binding Source: UniProtKB-UniRule
structural constituent of ribosome Source: InterPro

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

translation Source: UniProtKB-UniRule

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Molecular function

Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: 50S ribosomal protein L22UniRule annotation Alternative name(s): Hl23 Hmal22
Gene namesⁱ	Name:rpl22UniRule annotation Ordered Locus Names:rrnAC1606
Organismⁱ	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)
Taxonomic identifierⁱ	272569 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Archaea › Euryarchaeota › Stenosarchaea group › Halobacteria › Halobacteriales › Haloarculaceae › Haloarcula › Haloarcula marismortui
Proteomesⁱ	UP000001169 Componentⁱ: Chromosome I

Subcellular locationⁱ

GO - Cellular componentⁱ

large ribosomal subunit Source: InterPro

View the complete GO annotation on QuickGO ...

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		Removed2 Publications
ChainⁱPRO_0000125272	2 – 155	50S ribosomal protein L22Add BLAST		154

Interactionⁱ

Subunit structureⁱ

Part of the 50S ribosomal subunit. Contacts the macrolide antibiotic tylosin in the polypeptide exit tunnel.UniRule annotation2 Publications

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1606

STRINGⁱ

272569.rrnAC1606

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	11 – 13	Combined sources	3
Beta strandⁱ	14 – 22	Combined sources	9
Helixⁱ	26 – 36	Combined sources	11
Helixⁱ	41 – 52	Combined sources	12
Beta strandⁱ	61 – 63	Combined sources	3
Beta strandⁱ	74 – 80	Combined sources	7
Helixⁱ	83 – 102	Combined sources	20
Helixⁱ	107 – 109	Combined sources	3
Beta strandⁱ	110 – 123	Combined sources	14
Beta strandⁱ	126 – 128	Combined sources	3
Helixⁱ	130 – 132	Combined sources	3
Beta strandⁱ	134 – 136	Combined sources	3
Beta strandⁱ	139 – 149	Combined sources	11

Show more details

3D structure databases

ProteinModelPortalⁱ	P10970
SMRⁱ	P10970
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P10970

EvolutionaryTraceⁱ

P10970

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the universal ribosomal protein uL22 family.UniRule annotation

Phylogenomic databases

eggNOGⁱ	arCOG04098 Archaea COG0091 LUCA
HOGENOMⁱ	HOG000205045
KEGG Orthology (KO) More...KOⁱ	K02890
OMAⁱ	ANAEYKG
Database of Orthologous Groups More...OrthoDBⁱ	POG093Z0GN5

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00336 Ribosomal_L22, 1 hit
Gene3Dⁱ	3.90.470.10, 1 hit
HAMAPⁱ	MF_01331_A Ribosomal_L22_A, 1 hit
InterProⁱ	View protein in InterPro IPR001063 Ribosomal_L22 IPR018260 Ribosomal_L22/L17_CS IPR005721 Ribosomal_L22/L17_euk/arc IPR036394 Ribosomal_L22/L17_sf
PANTHERⁱ	PTHR11593 PTHR11593, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00237 Ribosomal_L22, 1 hit
SUPFAMⁱ	SSF54843 SSF54843, 1 hit
TIGRFAMsⁱ	TIGR01038 uL22_arch_euk, 1 hit
PROSITEⁱ	View protein in PROSITE PS00464 RIBOSOMAL_L22, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P10970-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MGISYSVEAD PDTTAKAMLR ERQMSFKHSK AIAREIKGKT AGEAVDYLEA 
        60         70         80         90        100
VIEGDQPVPF KQHNSGVGHK SKVDGWDAGR YPEKASKAFL DLLENAVGNA 
       110        120        130        140        150
DHQGFDGEAM TIKHVAAHKV GEQQGRKPRA MGRASAWNSP QVDVELILEE 

PEVED

Length:155

Mass (Da):16,941

Last modified:January 23, 2007 - v2

Checksum:ⁱE6730272296C0D7C

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	J05222 Genomic DNA Translation: AAA86864.1 AY596297 Genomic DNA Translation: AAV46523.1
PIRⁱ	H35063 R5HS22
NCBI Reference Sequences More...RefSeqⁱ	WP_011223742.1, NC_006396.1

Genome annotation databases

EnsemblBacteriaⁱ	AAV46523; AAV46523; rrnAC1606
GeneIDⁱ	3128443
KEGGⁱ	hma:rrnAC1606
PATRICⁱ	fig\|272569.17.peg.2296

Protein	Similar proteins		Species	Score	Length	Source
P10970	50S ribosomal protein L22		Haloarcula sp. K1		155	UniRef90_P10970
50S ribosomal protein L22		Haloarcula amylolytica JCM 13557		155
50S ribosomal protein L22		HALHT		155
50S ribosomal protein L22		Haloarcula hispanica N601		155
50S ribosomal protein L22		Haloarcula sp. CBA1115		155
+11

Protein	Similar proteins		Species	Score	Length	Source
P10970	50S ribosomal protein L22		HALSA		156	UniRef50_P10970
50S ribosomal protein L22		HALWD		158
50S ribosomal protein L22		NATPD		154
50S ribosomal protein L22		Haloarcula japonica DSM 6131		155
50S ribosomal protein L22		Haloarcula vallismortis ATCC 29715		155
+286

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	J05222 Genomic DNA Translation: AAA86864.1 AY596297 Genomic DNA Translation: AAV46523.1
PIRⁱ	H35063 R5HS22
RefSeqⁱ	WP_011223742.1, NC_006396.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1FFK	X-ray	2.40	O	2-155	[»]
	1JJ2	X-ray	2.40	Q	2-155	[»]
	1K73	X-ray	3.01	S	2-155	[»]
	1K8A	X-ray	3.00	S	2-155	[»]
	1K9M	X-ray	3.00	S	2-155	[»]
	1KC8	X-ray	3.01	S	2-155	[»]
	1KD1	X-ray	3.00	S	2-155	[»]
	1KQS	X-ray	3.10	Q	2-155	[»]
	1M1K	X-ray	3.20	S	2-155	[»]
	1M90	X-ray	2.80	S	2-155	[»]
	1N8R	X-ray	3.00	S	2-155	[»]
	1NJI	X-ray	3.00	S	2-155	[»]
	1Q7Y	X-ray	3.20	S	2-155	[»]
	1Q81	X-ray	2.95	S	2-155	[»]
	1Q82	X-ray	2.98	S	2-155	[»]
	1Q86	X-ray	3.00	S	2-155	[»]
	1QVF	X-ray	3.10	Q	2-155	[»]
	1QVG	X-ray	2.90	Q	2-155	[»]
	1S72	X-ray	2.40	R	1-155	[»]
	1VQ4	X-ray	2.70	R	1-155	[»]
	1VQ5	X-ray	2.60	R	1-155	[»]
	1VQ6	X-ray	2.70	R	1-155	[»]
	1VQ7	X-ray	2.50	R	1-155	[»]
	1VQ8	X-ray	2.20	R	1-155	[»]
	1VQ9	X-ray	2.40	R	1-155	[»]
	1VQK	X-ray	2.30	R	1-155	[»]
	1VQL	X-ray	2.30	R	1-155	[»]
	1VQM	X-ray	2.30	R	1-155	[»]
	1VQN	X-ray	2.40	R	1-155	[»]
	1VQO	X-ray	2.20	R	1-155	[»]
	1VQP	X-ray	2.25	R	1-155	[»]
	1W2B	X-ray	3.50	Q	2-155	[»]
	1YHQ	X-ray	2.40	R	1-155	[»]
	1YI2	X-ray	2.65	R	1-155	[»]
	1YIJ	X-ray	2.60	R	1-155	[»]
	1YIT	X-ray	2.80	R	1-155	[»]
	1YJ9	X-ray	2.80	R	1-152	[»]
	1YJN	X-ray	3.00	R	1-155	[»]
	1YJW	X-ray	2.90	R	1-155	[»]
	2OTJ	X-ray	2.90	R	1-155	[»]
	2OTL	X-ray	2.70	R	1-155	[»]
	2QA4	X-ray	3.00	R	1-155	[»]
	2QEX	X-ray	2.90	R	1-155	[»]
	3CC2	X-ray	2.40	R	1-155	[»]
	3CC4	X-ray	2.70	R	1-155	[»]
	3CC7	X-ray	2.70	R	1-155	[»]
	3CCE	X-ray	2.75	R	1-155	[»]
	3CCJ	X-ray	2.70	R	1-155	[»]
	3CCL	X-ray	2.90	R	1-155	[»]
	3CCM	X-ray	2.55	R	1-155	[»]
	3CCQ	X-ray	2.90	R	1-155	[»]
	3CCR	X-ray	3.00	R	1-155	[»]
	3CCS	X-ray	2.95	R	1-155	[»]
	3CCU	X-ray	2.80	R	1-155	[»]
	3CCV	X-ray	2.90	R	1-155	[»]
	3CD6	X-ray	2.75	R	1-155	[»]
	3CMA	X-ray	2.80	R	1-155	[»]
	3CME	X-ray	2.95	R	1-155	[»]
	3CPW	X-ray	2.70	Q	1-155	[»]
	3CXC	X-ray	3.00	Q	2-155	[»]
	3G4S	X-ray	3.20	R	2-151	[»]
	3G6E	X-ray	2.70	R	2-151	[»]
	3G71	X-ray	2.85	R	2-151	[»]
3I55	X-ray	3.11	R	1-155	[»]
3I56	X-ray	2.90	R	1-155	[»]
3OW2	X-ray	2.70	Q	2-151	[»]
4ADX	electron microscopy	6.60	R	1-155	[»]
4V9F	X-ray	2.40	R	1-155	[»]
ProteinModelPortalⁱ	P10970
SMRⁱ	P10970
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1606

STRINGⁱ

272569.rrnAC1606

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAV46523; AAV46523; rrnAC1606
GeneIDⁱ	3128443
KEGGⁱ	hma:rrnAC1606
PATRICⁱ	fig\|272569.17.peg.2296

Phylogenomic databases

eggNOGⁱ	arCOG04098 Archaea COG0091 LUCA
HOGENOMⁱ	HOG000205045
KOⁱ	K02890
OMAⁱ	ANAEYKG
OrthoDBⁱ	POG093Z0GN5

Miscellaneous databases

EvolutionaryTraceⁱ	P10970

EvolutionaryTraceⁱ

P10970

Family and domain databases

CDDⁱ	cd00336 Ribosomal_L22, 1 hit
Gene3Dⁱ	3.90.470.10, 1 hit
HAMAPⁱ	MF_01331_A Ribosomal_L22_A, 1 hit
InterProⁱ	View protein in InterPro IPR001063 Ribosomal_L22 IPR018260 Ribosomal_L22/L17_CS IPR005721 Ribosomal_L22/L17_euk/arc IPR036394 Ribosomal_L22/L17_sf
PANTHERⁱ	PTHR11593 PTHR11593, 1 hit
Pfamⁱ	View protein in Pfam PF00237 Ribosomal_L22, 1 hit
SUPFAMⁱ	SSF54843 SSF54843, 1 hit
TIGRFAMsⁱ	TIGR01038 uL22_arch_euk, 1 hit
PROSITEⁱ	View protein in PROSITE PS00464 RIBOSOMAL_L22, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RL22_HALMA
Accessionⁱ	P10970Primary (citable) accession number: P10970 Secondary accession number(s): Q5V1S9
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 1, 1989
	Last sequence update:	January 23, 2007
	Last modified:	October 10, 2018
	This is version 134 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P10970 (RL22_HALMA)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

50S ribosomal protein L22

rpl22

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protocols and materials databases

Genome annotation databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ