Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

T-cell surface glycoprotein CD8 beta chain

Gene

CD8B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. A palmitoylation site in the cytoplasmic tail of CD8B chain contributes to partitioning of CD8 into the plasma membrane lipid rafts where signaling proteins are enriched. Once LCK recruited, it initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). Additionally, plays a critical role in thymic selection of CD8+ T-cells.By similarity3 Publications

GO - Molecular functioni

  • coreceptor activity Source: UniProtKB
  • MHC class I protein binding Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processAdaptive immunity, Immunity

Enzyme and pathway databases

ReactomeiR-HSA-182218 Nef Mediated CD8 Down-regulation
R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Names & Taxonomyi

Protein namesi
Recommended name:
T-cell surface glycoprotein CD8 beta chain
Alternative name(s):
CD_antigen: CD8b
Gene namesi
Name:CD8B
Synonyms:CD8B1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000172116.21
HGNCiHGNC:1707 CD8B
MIMi186730 gene
neXtProtiNX_P10966

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini22 – 170ExtracellularSequence analysisAdd BLAST149
Transmembranei171 – 191HelicalSequence analysisAdd BLAST21
Topological domaini192 – 210CytoplasmicSequence analysisAdd BLAST19

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi926
OpenTargetsiENSG00000172116
PharmGKBiPA26245

Polymorphism and mutation databases

BioMutaiCD8B
DMDMi116032

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Add BLAST21
ChainiPRO_000001464322 – 210T-cell surface glycoprotein CD8 beta chainAdd BLAST189

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi41 ↔ 116PROSITE-ProRule annotation
Glycosylationi102N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei209PhosphotyrosineSequence analysis1

Post-translational modificationi

Phosphorylated as a consequence of T-cell activation.Curated
Palmitoylated at the cytoplasmic tail and thereby targets the heterodimer CD8A/CD8B to lipid rafts unlike CD8A homodimers.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiP10966
PeptideAtlasiP10966
PRIDEiP10966
ProteomicsDBi52679
52680 [P10966-2]
52681 [P10966-3]
52682 [P10966-4]
52683 [P10966-6]
52684 [P10966-7]
52685 [P10966-8]
52686 [P10966-9]

PTM databases

iPTMnetiP10966
PhosphoSitePlusiP10966
SwissPalmiP10966

Expressioni

Tissue specificityi

Isoform 1, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8 are expressed in both thymus and peripheral CD8+ T-cells. Expression of isoform 1 is higher in thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of isoform 6 is higher in peripheral CD8+ T-cells than in thymus CD8+ T-cells.1 Publication

Gene expression databases

BgeeiENSG00000172116 Expressed in 106 organ(s), highest expression level in leukocyte
CleanExiHS_CD8B
ExpressionAtlasiP10966 baseline and differential
GenevisibleiP10966 HS

Organism-specific databases

HPAiCAB004353
HPA029164

Interactioni

Subunit structurei

Forms disulfide-linked heterodimers with CD8A at the cell surface. Interacts with CD3D; this interaction couples TCR-CD3 with CD8. Interacts with LCK.By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107364, 9 interactors
STRINGi9606.ENSP00000331172

Structurei

3D structure databases

ProteinModelPortaliP10966
SMRiP10966
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini22 – 132Ig-like V-typeAdd BLAST111

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IY5X Eukaryota
ENOG410ZF37 LUCA
GeneTreeiENSGT00510000048998
HOGENOMiHOG000008681
HOVERGENiHBG105700
InParanoidiP10966
KOiK06459
OMAiYFCMTIG
OrthoDBiEOG091G0T5W
PhylomeDBiP10966
TreeFamiTF338028

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
PfamiView protein in Pfam
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00406 IGv, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

Sequences (8+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P10966-1) [UniParc]FASTAAdd to basket
Also known as: M-1, Mbeta1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRPRLWLLLA AQLTVLHGNS VLQQTPAYIK VQTNKMVMLS CEAKISLSNM
60 70 80 90 100
RIYWLRQRQA PSSDSHHEFL ALWDSAKGTI HGEEVEQEKI AVFRDASRFI
110 120 130 140 150
LNLTSVKPED SGIYFCMIVG SPELTFGKGT QLSVVDFLPT TAQPTKKSTL
160 170 180 190 200
KKRVCRLPRP ETQKGPLCSP ITLGLLVAGV LVLLVSLGVA IHLCCRRRRA
210
RLRFMKQFYK
Length:210
Mass (Da):23,722
Last modified:July 1, 1989 - v1
Checksum:i675AD919585F4B80
GO
Isoform 2 (identifier: P10966-2) [UniParc]FASTAAdd to basket
Also known as: M-3, Mbeta2

The sequence of this isoform differs from the canonical sequence as follows:
     208-210: FYK → LRLHPLEKCSRMDY

Show »
Length:221
Mass (Da):25,027
Checksum:iF5D8E834AE123671
GO
Isoform 3 (identifier: P10966-3) [UniParc]FASTAAdd to basket
Also known as: S-1, Sbeta3

The sequence of this isoform differs from the canonical sequence as follows:
     166-195: Missing.
     208-210: FYK → PQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT

Show »
Length:213
Mass (Da):24,276
Checksum:i79F81C2F066900D3
GO
Isoform 4 (identifier: P10966-4) [UniParc]FASTAAdd to basket
Also known as: M-2

The sequence of this isoform differs from the canonical sequence as follows:
     208-210: FYK → KFNIVCLKISGFTTCCCFQILQISREYGFGVLLQKDIGQ

Show »
Length:246
Mass (Da):27,681
Checksum:i33E6112A23CE59CD
GO
Isoform 5 (identifier: P10966-6) [UniParc]FASTAAdd to basket
Also known as: Mbeta3

The sequence of this isoform differs from the canonical sequence as follows:
     208-210: FYK → PQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT

Show »
Length:243
Mass (Da):27,246
Checksum:i9D6B283609CC0752
GO
Isoform 6 (identifier: P10966-7) [UniParc]FASTAAdd to basket
Also known as: Sbeta1

The sequence of this isoform differs from the canonical sequence as follows:
     166-195: Missing.

Show »
Length:180
Mass (Da):20,752
Checksum:iDBE4D7A3B6A30F58
GO
Isoform 7 (identifier: P10966-8) [UniParc]FASTAAdd to basket
Also known as: Sbeta4

The sequence of this isoform differs from the canonical sequence as follows:
     165-210: GPLCSPITLG...RLRFMKQFYK → DFTNKQRIGF...TFNPGEFNGC

Show »
Length:206
Mass (Da):23,633
Checksum:iEE0A2D77A82570D4
GO
Isoform 8 (identifier: P10966-9) [UniParc]FASTAAdd to basket
Also known as: Sbeta5

The sequence of this isoform differs from the canonical sequence as follows:
     166-210: PLCSPITLGL...RLRFMKQFYK → LKGKVYQEPLSPNACMDTTAILQPHRSCLTHGS

Show »
Length:198
Mass (Da):22,237
Checksum:i57D5DEB69D193C5A
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PD41E9PD41_HUMAN
T-cell surface glycoprotein CD8 bet...
CD8B
210Annotation score:

Sequence cautioni

The sequence AAD13877 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti173Missing no nucleotide entry (PubMed:8436166).Curated1
Sequence conflicti180V → I in AAI00915 (PubMed:15489334).Curated1
Isoform 5 (identifier: P10966-6)
Sequence conflicti213I → V in AAI00915 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_039654165 – 210GPLCS…KQFYK → DFTNKQRIGFWCPATKRHRS VMSTMWKNERRDTFNPGEFN GC in isoform 7. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_039655166 – 210PLCSP…KQFYK → LKGKVYQEPLSPNACMDTTA ILQPHRSCLTHGS in isoform 8. 2 PublicationsAdd BLAST45
Alternative sequenceiVSP_002492166 – 195Missing in isoform 3 and isoform 6. 2 PublicationsAdd BLAST30
Alternative sequenceiVSP_002490208 – 210FYK → LRLHPLEKCSRMDY in isoform 2. 2 Publications3
Alternative sequenceiVSP_002493208 – 210FYK → PQGEGISGTFVPQCLHGYYS NTTTSQKLLNPWILKT in isoform 3 and isoform 5. 3 Publications3
Alternative sequenceiVSP_002491208 – 210FYK → KFNIVCLKISGFTTCCCFQI LQISREYGFGVLLQKDIGQ in isoform 4. Curated3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X13444 mRNA Translation: CAA31795.1
X13445 mRNA Translation: CAA31796.1
X13446 mRNA Translation: CAA31797.1
X13452 mRNA Translation: CAA31803.1
Y00805 mRNA Translation: CAA68750.1
M36712 mRNA Translation: AAA35664.1
S87090
, S87068, S87070, S87073, S87081 Genomic DNA Translation: AAB21669.2
S87087
, S87068, S87070, S87073, S87078, S87081 Genomic DNA Translation: AAB21670.2
S87083
, S87068, S87070, S87073, S87078, S87081 Genomic DNA Translation: AAB21671.2
S87083
, S87068, S87070, S87073, S87078, S87081 Genomic DNA Translation: AAB21672.2
AC111200 Genomic DNA No translation available.
BC100911 mRNA Translation: AAI00912.1
BC100912 mRNA Translation: AAI00913.1
BC100913 mRNA Translation: AAI00914.1
BC100914 mRNA Translation: AAI00915.1
S55731, S55730, S55733 Genomic DNA Translation: AAD13877.1 Sequence problems.
CCDSiCCDS1994.1 [P10966-3]
CCDS1995.1 [P10966-6]
CCDS1997.1 [P10966-1]
CCDS42708.1 [P10966-2]
CCDS54376.1 [P10966-9]
PIRiC49050
D46482
E49050
G49050
S01647 E46482
S01873 C46482
S01874 B46482
T01073
RefSeqiNP_001171571.1, NM_001178100.1 [P10966-9]
NP_004922.1, NM_004931.4 [P10966-1]
NP_742099.1, NM_172101.3 [P10966-2]
NP_742100.1, NM_172102.3 [P10966-3]
NP_757362.1, NM_172213.3 [P10966-6]
UniGeneiHs.405667

Genome annotation databases

EnsembliENST00000331469; ENSP00000331172; ENSG00000172116 [P10966-6]
ENST00000349455; ENSP00000340592; ENSG00000172116 [P10966-3]
ENST00000390655; ENSP00000375070; ENSG00000172116 [P10966-1]
ENST00000393759; ENSP00000377356; ENSG00000172116 [P10966-2]
ENST00000393761; ENSP00000377358; ENSG00000172116 [P10966-9]
GeneIDi926
KEGGihsa:926
UCSCiuc002srw.4 human [P10966-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Web resourcesi

Wikipedia

CD8 entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X13444 mRNA Translation: CAA31795.1
X13445 mRNA Translation: CAA31796.1
X13446 mRNA Translation: CAA31797.1
X13452 mRNA Translation: CAA31803.1
Y00805 mRNA Translation: CAA68750.1
M36712 mRNA Translation: AAA35664.1
S87090
, S87068, S87070, S87073, S87081 Genomic DNA Translation: AAB21669.2
S87087
, S87068, S87070, S87073, S87078, S87081 Genomic DNA Translation: AAB21670.2
S87083
, S87068, S87070, S87073, S87078, S87081 Genomic DNA Translation: AAB21671.2
S87083
, S87068, S87070, S87073, S87078, S87081 Genomic DNA Translation: AAB21672.2
AC111200 Genomic DNA No translation available.
BC100911 mRNA Translation: AAI00912.1
BC100912 mRNA Translation: AAI00913.1
BC100913 mRNA Translation: AAI00914.1
BC100914 mRNA Translation: AAI00915.1
S55731, S55730, S55733 Genomic DNA Translation: AAD13877.1 Sequence problems.
CCDSiCCDS1994.1 [P10966-3]
CCDS1995.1 [P10966-6]
CCDS1997.1 [P10966-1]
CCDS42708.1 [P10966-2]
CCDS54376.1 [P10966-9]
PIRiC49050
D46482
E49050
G49050
S01647 E46482
S01873 C46482
S01874 B46482
T01073
RefSeqiNP_001171571.1, NM_001178100.1 [P10966-9]
NP_004922.1, NM_004931.4 [P10966-1]
NP_742099.1, NM_172101.3 [P10966-2]
NP_742100.1, NM_172102.3 [P10966-3]
NP_757362.1, NM_172213.3 [P10966-6]
UniGeneiHs.405667

3D structure databases

ProteinModelPortaliP10966
SMRiP10966
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107364, 9 interactors
STRINGi9606.ENSP00000331172

PTM databases

iPTMnetiP10966
PhosphoSitePlusiP10966
SwissPalmiP10966

Polymorphism and mutation databases

BioMutaiCD8B
DMDMi116032

Proteomic databases

PaxDbiP10966
PeptideAtlasiP10966
PRIDEiP10966
ProteomicsDBi52679
52680 [P10966-2]
52681 [P10966-3]
52682 [P10966-4]
52683 [P10966-6]
52684 [P10966-7]
52685 [P10966-8]
52686 [P10966-9]

Protocols and materials databases

DNASUi926
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000331469; ENSP00000331172; ENSG00000172116 [P10966-6]
ENST00000349455; ENSP00000340592; ENSG00000172116 [P10966-3]
ENST00000390655; ENSP00000375070; ENSG00000172116 [P10966-1]
ENST00000393759; ENSP00000377356; ENSG00000172116 [P10966-2]
ENST00000393761; ENSP00000377358; ENSG00000172116 [P10966-9]
GeneIDi926
KEGGihsa:926
UCSCiuc002srw.4 human [P10966-1]

Organism-specific databases

CTDi926
DisGeNETi926
EuPathDBiHostDB:ENSG00000172116.21
GeneCardsiCD8B
HGNCiHGNC:1707 CD8B
HPAiCAB004353
HPA029164
MIMi186730 gene
neXtProtiNX_P10966
OpenTargetsiENSG00000172116
PharmGKBiPA26245
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IY5X Eukaryota
ENOG410ZF37 LUCA
GeneTreeiENSGT00510000048998
HOGENOMiHOG000008681
HOVERGENiHBG105700
InParanoidiP10966
KOiK06459
OMAiYFCMTIG
OrthoDBiEOG091G0T5W
PhylomeDBiP10966
TreeFamiTF338028

Enzyme and pathway databases

ReactomeiR-HSA-182218 Nef Mediated CD8 Down-regulation
R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Miscellaneous databases

GenomeRNAii926
PROiPR:P10966
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000172116 Expressed in 106 organ(s), highest expression level in leukocyte
CleanExiHS_CD8B
ExpressionAtlasiP10966 baseline and differential
GenevisibleiP10966 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
PfamiView protein in Pfam
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00406 IGv, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCD8B_HUMAN
AccessioniPrimary (citable) accession number: P10966
Secondary accession number(s): P14860
, P14861, Q15980, Q496E0, Q496E1, Q496E2, Q9UDB4, Q9UDB5, Q9UDB6, Q9UDB7, Q9UDB8, Q9UDB9, Q9UDC0, Q9UQ55
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: July 1, 1989
Last modified: November 7, 2018
This is version 186 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again