Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Clusterin

Gene

CLU

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Isoform 1 functions as extracellular chaperone that prevents aggregation of nonnative proteins. Prevents stress-induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. Secreted isoform 1 protects cells against apoptosis and against cytolysis by complement. Intracellular isoforms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity. Nuclear isoforms promote apoptosis. Mitochondrial isoforms suppress BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis. Plays a role in the regulation of cell proliferation.15 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • amyloid-beta binding Source: ARUK-UCL
  • chaperone binding Source: ParkinsonsUK-UCL
  • low-density lipoprotein particle receptor binding Source: ARUK-UCL
  • misfolded protein binding Source: UniProtKB
  • protein-containing complex binding Source: ARUK-UCL
  • protein heterodimerization activity Source: ARUK-UCL
  • tau protein binding Source: ARUK-UCL
  • ubiquitin protein ligase binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone
Biological processApoptosis, Complement pathway, Immunity, Innate immunity

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-114608 Platelet degranulation
R-HSA-166665 Terminal pathway of complement
R-HSA-6803157 Antimicrobial peptides
R-HSA-977606 Regulation of Complement cascade

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P10909

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Clusterin
Alternative name(s):
Aging-associated gene 4 protein
Apolipoprotein J
Short name:
Apo-J
Complement cytolysis inhibitor
Short name:
CLI
Complement-associated protein SP-40,40
Ku70-binding protein 1
NA1/NA2
Testosterone-repressed prostate message 2
Short name:
TRPM-2
Cleaved into the following 2 chains:
Alternative name(s):
ApoJalpha
Complement cytolysis inhibitor a chain
Alternative name(s):
ApoJbeta
Complement cytolysis inhibitor b chain
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CLU
Synonyms:APOJ, CLI, KUB1
ORF Names:AAG4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000120885.19

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2095 CLU

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
185430 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P10909

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum, Membrane, Microsome, Mitochondrion, Nucleus, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1191

Open Targets

More...
OpenTargetsi
ENSG00000120885

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26620

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CLU

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116533

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 226 PublicationsAdd BLAST22
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000552923 – 449ClusterinAdd BLAST427
ChainiPRO_000000553023 – 227Clusterin beta chain1 PublicationAdd BLAST205
ChainiPRO_0000005531228 – 449Clusterin alpha chain1 PublicationAdd BLAST222

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi86N-linked (GlcNAc...) (complex) asparagine5 Publications1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi102 ↔ 313Interchain (between beta and alpha chains)
Glycosylationi103N-linked (GlcNAc...) asparagine5 Publications1
Disulfide bondi113 ↔ 305Interchain (between beta and alpha chains)
Disulfide bondi116 ↔ 302Interchain (between beta and alpha chains)
Disulfide bondi121 ↔ 295Interchain (between beta and alpha chains)
Disulfide bondi129 ↔ 285Interchain (between beta and alpha chains)
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei133PhosphoserineCombined sources1
Glycosylationi145N-linked (GlcNAc...) asparagine5 Publications1
Glycosylationi291N-linked (GlcNAc...) asparagine5 Publications1
Glycosylationi354N-linked (GlcNAc...) asparagine6 Publications1
Glycosylationi374N-linked (GlcNAc...) (complex) asparagine10 Publications1
Modified residuei396PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Isoform 1 is proteolytically cleaved on its way through the secretory system, probably within the Golgi lumen.1 Publication
Polyubiquitinated, leading to proteasomal degradation.2 Publications
Heavily N-glycosylated. About 30% of the protein mass is comprised of complex N-linked carbohydrate.13 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P10909

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P10909

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P10909

PeptideAtlas

More...
PeptideAtlasi
P10909

PRoteomics IDEntifications database

More...
PRIDEi
P10909

ProteomicsDB human proteome resource

More...
ProteomicsDBi
52663
52664 [P10909-2]
52665 [P10909-3]
52666 [P10909-4]
52667 [P10909-5]

2D gel databases

DOSAC-COBS 2D-PAGE database

More...
DOSAC-COBS-2DPAGEi
P10909

USC-OGP 2-DE database

More...
OGPi
P10909

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
IPI00291262

Two-dimensional polyacrylamide gel electrophoresis database from the Geneva University Hospital

More...
SWISS-2DPAGEi
P10909

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
P10909

GlyConnect protein glycosylation platform

More...
GlyConnecti
759

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P10909

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P10909

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P10909

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in blood plasma, cerebrospinal fluid, milk, seminal plasma and colon mucosa. Detected in the germinal center of colon lymphoid nodules and in colon parasympathetic ganglia of the Auerbach plexus (at protein level). Ubiquitous. Detected in brain, testis, ovary, liver and pancreas, and at lower levels in kidney, heart, spleen and lung.11 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in response to enterovirus 71 (EV71) infection (at protein level). Up-regulated by agents that induce apoptosis, both at mRNA and protein level. Isoform 1 is up-regulated by androgen. Isoform 2 is down-regulated by androgen.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000120885 Expressed in 238 organ(s), highest expression level in tendon of biceps brachii

CleanEx database of gene expression profiles

More...
CleanExi
HS_CLU

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P10909 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P10909 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB016253
HPA000572

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Antiparallel disulfide-linked heterodimer of an alpha chain and a beta chain. Self-associates and forms higher oligomers. Interacts with a broad range of misfolded proteins, including APP, APOC2 and LYZ. Slightly acidic pH promotes interaction with misfolded proteins. Forms high-molecular weight oligomers upon interaction with misfolded proteins. Interacts with APOA1, LRP2, CLUAP1 AND PON1. Interacts with the complement complex. Interacts (via alpha chain) with XRCC6. Interacts with SYVN1, COMMD1, BTRC, CUL1 and with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes. Interacts (via alpha chain) with BAX in stressed cells, where BAX undergoes a conformation change leading to association with the mitochondrial membrane. Does not interact with BAX in unstressed cells. Found in a complex with LTF, CLU, EPPIN and SEMG1.21 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107603, 155 interactors

Database of interacting proteins

More...
DIPi
DIP-37546N

Protein interaction database and analysis system

More...
IntActi
P10909, 55 interactors

Molecular INTeraction database

More...
MINTi
P10909

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000315130

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P10909

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi78 – 81Nuclear localization signalBy similarity4
Motifi443 – 447Nuclear localization signalBy similarity5

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the clusterin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IHRB Eukaryota
ENOG410YYKB LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063668

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG006908

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P10909

KEGG Orthology (KO)

More...
KOi
K17252

Identification of Orthologs from Complete Genome Data

More...
OMAi
FMETVAE

Database of Orthologous Groups

More...
OrthoDBi
EOG091G05R5

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P10909

TreeFam database of animal gene trees

More...
TreeFami
TF333030

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016016 Clusterin
IPR000753 Clusterin-like
IPR016015 Clusterin_C
IPR033986 Clusterin_CS
IPR016014 Clusterin_N

The PANTHER Classification System

More...
PANTHERi
PTHR10970 PTHR10970, 1 hit
PTHR10970:SF1 PTHR10970:SF1, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01093 Clusterin, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF002368 Clusterin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00035 CLa, 1 hit
SM00030 CLb, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00492 CLUSTERIN_1, 1 hit
PS00493 CLUSTERIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P10909-1) [UniParc]FASTAAdd to basket
Also known as: 2, CLU35, sCLU

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMKTLLLFVG LLLTWESGQV LGDQTVSDNE LQEMSNQGSK YVNKEIQNAV
60 70 80 90 100
NGVKQIKTLI EKTNEERKTL LSNLEEAKKK KEDALNETRE SETKLKELPG
110 120 130 140 150
VCNETMMALW EECKPCLKQT CMKFYARVCR SGSGLVGRQL EEFLNQSSPF
160 170 180 190 200
YFWMNGDRID SLLENDRQQT HMLDVMQDHF SRASSIIDEL FQDRFFTREP
210 220 230 240 250
QDTYHYLPFS LPHRRPHFFF PKSRIVRSLM PFSPYEPLNF HAMFQPFLEM
260 270 280 290 300
IHEAQQAMDI HFHSPAFQHP PTEFIREGDD DRTVCREIRH NSTGCLRMKD
310 320 330 340 350
QCDKCREILS VDCSTNNPSQ AKLRRELDES LQVAERLTRK YNELLKSYQW
360 370 380 390 400
KMLNTSSLLE QLNEQFNWVS RLANLTQGED QYYLRVTTVA SHTSDSDVPS
410 420 430 440
GVTEVVVKLF DSDPITVTVP VEVSRKNPKF METVAEKALQ EYRKKHREE
Note: Major isoform.
Length:449
Mass (Da):52,495
Last modified:July 1, 1989 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9583DE4CCECC169F
GO
Isoform 2 (identifier: P10909-2) [UniParc]FASTAAdd to basket
Also known as: 1, CLU34

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQVCSQPQRGCVREQSAINTAPPSAHNAASPGGARGHRVPLTEACKDSRIGGM

Show »
Length:501
Mass (Da):57,833
Checksum:i1941842E61CD3464
GO
Isoform 3 (identifier: P10909-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-175: Missing.

Show »
Length:274
Mass (Da):32,364
Checksum:i0917960A8B4D6857
GO
Isoform 4 (identifier: P10909-4) [UniParc]FASTAAdd to basket
Also known as: nCLU

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: Missing.

Note: Minor isoform that has been detected in a breast cancer cell line, but not in any other tissues or cell lines.
Show »
Length:416
Mass (Da):48,803
Checksum:i77900AB70F7AC243
GO
Isoform 5 (identifier: P10909-5) [UniParc]FASTAAdd to basket
Also known as: CLU36

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEACKDSRIGGM

Show »
Length:460
Mass (Da):53,643
Checksum:i0B0A0165A6C5622A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ETB4E7ETB4_HUMAN
Clusterin
CLU
271Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YC35H0YC35_HUMAN
Clusterin
CLU
284Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YLK8H0YLK8_HUMAN
Clusterin
CLU
297Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ERK6E7ERK6_HUMAN
Clusterin
CLU
204Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RGB0E5RGB0_HUMAN
Clusterin
CLU
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJZ5E5RJZ5_HUMAN
Clusterin
CLU
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RH61E5RH61_HUMAN
Clusterin
CLU
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RG36E5RG36_HUMAN
Clusterin
CLU
82Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJD6E5RJD6_HUMAN
Clusterin
CLU
32Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YAS8H0YAS8_HUMAN
Clusterin
CLU
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA35692 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAB06508 differs from that shown. Contaminating sequence.Curated
The sequence AAB06508 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH10514 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH19588 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAP88927 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAP88927 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAT08041 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAG36598 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAA32847 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti28D → S AA sequence (PubMed:1903064).Curated1
Sequence conflicti28D → S AA sequence (PubMed:3154963).Curated1
Sequence conflicti47Q → H AA sequence (PubMed:2387851).Curated1
Sequence conflicti52G → Q AA sequence (PubMed:2387851).Curated1
Sequence conflicti172M → V in CAI45990 (PubMed:17974005).Curated1
Sequence conflicti224R → L in BAG36598 (PubMed:14702039).Curated1
Sequence conflicti305C → M AA sequence (PubMed:1903064).Curated1
Sequence conflicti388T → M in CAI45990 (PubMed:17974005).Curated1
Sequence conflicti411D → G in BAG36598 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_019366317N → H1 PublicationCorresponds to variant dbSNP:rs9331936Ensembl.1
Natural variantiVAR_019367328D → N1 PublicationCorresponds to variant dbSNP:rs9331938Ensembl.1
Natural variantiVAR_019368396S → L1 PublicationCorresponds to variant dbSNP:rs13494Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0414751 – 175Missing in isoform 3. 1 PublicationAdd BLAST175
Alternative sequenceiVSP_0414761 – 33Missing in isoform 4. CuratedAdd BLAST33
Alternative sequenceiVSP_0376611M → MQVCSQPQRGCVREQSAINT APPSAHNAASPGGARGHRVP LTEACKDSRIGGM in isoform 2. 3 Publications1
Alternative sequenceiVSP_0414771M → MEACKDSRIGGM in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M25915 mRNA Translation: AAA35692.1 Different initiation.
M63379
, M63376, M63377, M63378 Genomic DNA Translation: AAB06507.1
M64722 mRNA Translation: AAB06508.1 Sequence problems.
AK093399 mRNA Translation: BAG52708.1
AK313870 mRNA Translation: BAG36598.1 Different initiation.
CR599675 mRNA No translation available.
BX648414 mRNA Translation: CAI45990.1
AY341244 Genomic DNA Translation: AAP88927.1 Different initiation.
AF311103 Genomic DNA No translation available.
BC010514 mRNA Translation: AAH10514.1 Different initiation.
BC019588 mRNA Translation: AAH19588.1 Different initiation.
BU150467 mRNA No translation available.
J02908 mRNA Translation: AAA51765.1
M74816 mRNA Translation: AAA60321.1
L00974 Genomic DNA Translation: AAA60567.1
X14723 mRNA Translation: CAA32847.1 Different initiation.
AY513288 mRNA Translation: AAT08041.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47832.1 [P10909-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S43646 A41386

NCBI Reference Sequences

More...
RefSeqi
NP_001822.3, NM_001831.3 [P10909-1]
XP_006716347.1, XM_006716284.2 [P10909-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.436657

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000316403; ENSP00000315130; ENSG00000120885 [P10909-1]
ENST00000405140; ENSP00000385419; ENSG00000120885 [P10909-1]
ENST00000523500; ENSP00000429620; ENSG00000120885 [P10909-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1191

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1191

UCSC genome browser

More...
UCSCi
uc003xfw.3 human [P10909-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs
Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M25915 mRNA Translation: AAA35692.1 Different initiation.
M63379
, M63376, M63377, M63378 Genomic DNA Translation: AAB06507.1
M64722 mRNA Translation: AAB06508.1 Sequence problems.
AK093399 mRNA Translation: BAG52708.1
AK313870 mRNA Translation: BAG36598.1 Different initiation.
CR599675 mRNA No translation available.
BX648414 mRNA Translation: CAI45990.1
AY341244 Genomic DNA Translation: AAP88927.1 Different initiation.
AF311103 Genomic DNA No translation available.
BC010514 mRNA Translation: AAH10514.1 Different initiation.
BC019588 mRNA Translation: AAH19588.1 Different initiation.
BU150467 mRNA No translation available.
J02908 mRNA Translation: AAA51765.1
M74816 mRNA Translation: AAA60321.1
L00974 Genomic DNA Translation: AAA60567.1
X14723 mRNA Translation: CAA32847.1 Different initiation.
AY513288 mRNA Translation: AAT08041.1 Different initiation.
CCDSiCCDS47832.1 [P10909-1]
PIRiS43646 A41386
RefSeqiNP_001822.3, NM_001831.3 [P10909-1]
XP_006716347.1, XM_006716284.2 [P10909-2]
UniGeneiHs.436657

3D structure databases

ProteinModelPortaliP10909
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107603, 155 interactors
DIPiDIP-37546N
IntActiP10909, 55 interactors
MINTiP10909
STRINGi9606.ENSP00000315130

PTM databases

CarbonylDBiP10909
GlyConnecti759
iPTMnetiP10909
PhosphoSitePlusiP10909

Polymorphism and mutation databases

BioMutaiCLU
DMDMi116533

2D gel databases

DOSAC-COBS-2DPAGEiP10909
OGPiP10909
REPRODUCTION-2DPAGEiIPI00291262
SWISS-2DPAGEiP10909

Proteomic databases

EPDiP10909
MaxQBiP10909
PaxDbiP10909
PeptideAtlasiP10909
PRIDEiP10909
ProteomicsDBi52663
52664 [P10909-2]
52665 [P10909-3]
52666 [P10909-4]
52667 [P10909-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
1191
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000316403; ENSP00000315130; ENSG00000120885 [P10909-1]
ENST00000405140; ENSP00000385419; ENSG00000120885 [P10909-1]
ENST00000523500; ENSP00000429620; ENSG00000120885 [P10909-1]
GeneIDi1191
KEGGihsa:1191
UCSCiuc003xfw.3 human [P10909-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1191
DisGeNETi1191
EuPathDBiHostDB:ENSG00000120885.19

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CLU
HGNCiHGNC:2095 CLU
HPAiCAB016253
HPA000572
MIMi185430 gene
neXtProtiNX_P10909
OpenTargetsiENSG00000120885
PharmGKBiPA26620

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IHRB Eukaryota
ENOG410YYKB LUCA
GeneTreeiENSGT00530000063668
HOVERGENiHBG006908
InParanoidiP10909
KOiK17252
OMAiFMETVAE
OrthoDBiEOG091G05R5
PhylomeDBiP10909
TreeFamiTF333030

Enzyme and pathway databases

ReactomeiR-HSA-114608 Platelet degranulation
R-HSA-166665 Terminal pathway of complement
R-HSA-6803157 Antimicrobial peptides
R-HSA-977606 Regulation of Complement cascade
SIGNORiP10909

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CLU human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Clusterin

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1191
PMAP-CutDBiP10909

Protein Ontology

More...
PROi
PR:P10909

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000120885 Expressed in 238 organ(s), highest expression level in tendon of biceps brachii
CleanExiHS_CLU
ExpressionAtlasiP10909 baseline and differential
GenevisibleiP10909 HS

Family and domain databases

InterProiView protein in InterPro
IPR016016 Clusterin
IPR000753 Clusterin-like
IPR016015 Clusterin_C
IPR033986 Clusterin_CS
IPR016014 Clusterin_N
PANTHERiPTHR10970 PTHR10970, 1 hit
PTHR10970:SF1 PTHR10970:SF1, 1 hit
PfamiView protein in Pfam
PF01093 Clusterin, 1 hit
PIRSFiPIRSF002368 Clusterin, 1 hit
SMARTiView protein in SMART
SM00035 CLa, 1 hit
SM00030 CLb, 1 hit
PROSITEiView protein in PROSITE
PS00492 CLUSTERIN_1, 1 hit
PS00493 CLUSTERIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCLUS_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P10909
Secondary accession number(s): B2R9Q1
, B3KSE6, P11380, P11381, Q2TU75, Q5HYC1, Q7Z5B9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: July 1, 1989
Last modified: December 5, 2018
This is version 215 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again