Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Clusterin

Gene

CLU

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Isoform 1 functions as extracellular chaperone that prevents aggregation of nonnative proteins. Prevents stress-induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. Secreted isoform 1 protects cells against apoptosis and against cytolysis by complement. Intracellular isoforms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity. Nuclear isoforms promote apoptosis. Mitochondrial isoforms suppress BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis. Plays a role in the regulation of cell proliferation.15 Publications

GO - Molecular functioni

  • amyloid-beta binding Source: ARUK-UCL
  • chaperone binding Source: ParkinsonsUK-UCL
  • low-density lipoprotein particle receptor binding Source: ARUK-UCL
  • misfolded protein binding Source: UniProtKB
  • protein-containing complex binding Source: ARUK-UCL
  • protein heterodimerization activity Source: ARUK-UCL
  • tau protein binding Source: ARUK-UCL
  • ubiquitin protein ligase binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionChaperone
Biological processApoptosis, Complement pathway, Immunity, Innate immunity

Enzyme and pathway databases

ReactomeiR-HSA-114608 Platelet degranulation
R-HSA-166665 Terminal pathway of complement
R-HSA-6803157 Antimicrobial peptides
R-HSA-977606 Regulation of Complement cascade
SIGNORiP10909

Names & Taxonomyi

Protein namesi
Recommended name:
Clusterin
Alternative name(s):
Aging-associated gene 4 protein
Apolipoprotein J
Short name:
Apo-J
Complement cytolysis inhibitor
Short name:
CLI
Complement-associated protein SP-40,40
Ku70-binding protein 1
NA1/NA2
Testosterone-repressed prostate message 2
Short name:
TRPM-2
Cleaved into the following 2 chains:
Alternative name(s):
ApoJalpha
Complement cytolysis inhibitor a chain
Alternative name(s):
ApoJbeta
Complement cytolysis inhibitor b chain
Gene namesi
Name:CLU
Synonyms:APOJ, CLI, KUB1
ORF Names:AAG4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000120885.19
HGNCiHGNC:2095 CLU
MIMi185430 gene
neXtProtiNX_P10909

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum, Membrane, Microsome, Mitochondrion, Nucleus, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi1191
OpenTargetsiENSG00000120885
PharmGKBiPA26620

Polymorphism and mutation databases

BioMutaiCLU
DMDMi116533

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 226 PublicationsAdd BLAST22
ChainiPRO_000000552923 – 449ClusterinAdd BLAST427
ChainiPRO_000000553023 – 227Clusterin beta chain1 PublicationAdd BLAST205
ChainiPRO_0000005531228 – 449Clusterin alpha chain1 PublicationAdd BLAST222

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi86N-linked (GlcNAc...) (complex) asparagine5 Publications1
Disulfide bondi102 ↔ 313Interchain (between beta and alpha chains)
Glycosylationi103N-linked (GlcNAc...) asparagine5 Publications1
Disulfide bondi113 ↔ 305Interchain (between beta and alpha chains)
Disulfide bondi116 ↔ 302Interchain (between beta and alpha chains)
Disulfide bondi121 ↔ 295Interchain (between beta and alpha chains)
Disulfide bondi129 ↔ 285Interchain (between beta and alpha chains)
Modified residuei133PhosphoserineCombined sources1
Glycosylationi145N-linked (GlcNAc...) asparagine5 Publications1
Glycosylationi291N-linked (GlcNAc...) asparagine5 Publications1
Glycosylationi354N-linked (GlcNAc...) asparagine6 Publications1
Glycosylationi374N-linked (GlcNAc...) (complex) asparagine10 Publications1
Modified residuei396PhosphoserineCombined sources1

Post-translational modificationi

Isoform 1 is proteolytically cleaved on its way through the secretory system, probably within the Golgi lumen.1 Publication
Polyubiquitinated, leading to proteasomal degradation.2 Publications
Heavily N-glycosylated. About 30% of the protein mass is comprised of complex N-linked carbohydrate.13 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP10909
MaxQBiP10909
PaxDbiP10909
PeptideAtlasiP10909
PRIDEiP10909
ProteomicsDBi52663
52664 [P10909-2]
52665 [P10909-3]
52666 [P10909-4]
52667 [P10909-5]

2D gel databases

DOSAC-COBS-2DPAGEiP10909
OGPiP10909
REPRODUCTION-2DPAGEiIPI00291262
SWISS-2DPAGEiP10909

PTM databases

CarbonylDBiP10909
GlyConnecti759
iPTMnetiP10909
PhosphoSitePlusiP10909

Miscellaneous databases

PMAP-CutDBiP10909

Expressioni

Tissue specificityi

Detected in blood plasma, cerebrospinal fluid, milk, seminal plasma and colon mucosa. Detected in the germinal center of colon lymphoid nodules and in colon parasympathetic ganglia of the Auerbach plexus (at protein level). Ubiquitous. Detected in brain, testis, ovary, liver and pancreas, and at lower levels in kidney, heart, spleen and lung.11 Publications

Inductioni

Up-regulated in response to enterovirus 71 (EV71) infection (at protein level). Up-regulated by agents that induce apoptosis, both at mRNA and protein level. Isoform 1 is up-regulated by androgen. Isoform 2 is down-regulated by androgen.3 Publications

Gene expression databases

BgeeiENSG00000120885 Expressed in 238 organ(s), highest expression level in tendon of biceps brachii
CleanExiHS_CLU
ExpressionAtlasiP10909 baseline and differential
GenevisibleiP10909 HS

Organism-specific databases

HPAiCAB016253
HPA000572

Interactioni

Subunit structurei

Antiparallel disulfide-linked heterodimer of an alpha chain and a beta chain. Self-associates and forms higher oligomers. Interacts with a broad range of misfolded proteins, including APP, APOC2 and LYZ. Slightly acidic pH promotes interaction with misfolded proteins. Forms high-molecular weight oligomers upon interaction with misfolded proteins. Interacts with APOA1, LRP2, CLUAP1 AND PON1. Interacts with the complement complex. Interacts (via alpha chain) with XRCC6. Interacts with SYVN1, COMMD1, BTRC, CUL1 and with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes. Interacts (via alpha chain) with BAX in stressed cells, where BAX undergoes a conformation change leading to association with the mitochondrial membrane. Does not interact with BAX in unstressed cells. Found in a complex with LTF, CLU, EPPIN and SEMG1.21 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107603, 154 interactors
DIPiDIP-37546N
IntActiP10909, 53 interactors
MINTiP10909
STRINGi9606.ENSP00000315130

Structurei

3D structure databases

ProteinModelPortaliP10909
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi78 – 81Nuclear localization signalBy similarity4
Motifi443 – 447Nuclear localization signalBy similarity5

Sequence similaritiesi

Belongs to the clusterin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IHRB Eukaryota
ENOG410YYKB LUCA
GeneTreeiENSGT00530000063668
HOVERGENiHBG006908
InParanoidiP10909
KOiK17252
OMAiFMETVAE
OrthoDBiEOG091G05R5
PhylomeDBiP10909
TreeFamiTF333030

Family and domain databases

InterProiView protein in InterPro
IPR016016 Clusterin
IPR000753 Clusterin-like
IPR016015 Clusterin_C
IPR033986 Clusterin_CS
IPR016014 Clusterin_N
PANTHERiPTHR10970 PTHR10970, 1 hit
PTHR10970:SF1 PTHR10970:SF1, 1 hit
PfamiView protein in Pfam
PF01093 Clusterin, 1 hit
PIRSFiPIRSF002368 Clusterin, 1 hit
SMARTiView protein in SMART
SM00035 CLa, 1 hit
SM00030 CLb, 1 hit
PROSITEiView protein in PROSITE
PS00492 CLUSTERIN_1, 1 hit
PS00493 CLUSTERIN_2, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P10909-1) [UniParc]FASTAAdd to basket
Also known as: 2, CLU35, sCLU

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMKTLLLFVG LLLTWESGQV LGDQTVSDNE LQEMSNQGSK YVNKEIQNAV
60 70 80 90 100
NGVKQIKTLI EKTNEERKTL LSNLEEAKKK KEDALNETRE SETKLKELPG
110 120 130 140 150
VCNETMMALW EECKPCLKQT CMKFYARVCR SGSGLVGRQL EEFLNQSSPF
160 170 180 190 200
YFWMNGDRID SLLENDRQQT HMLDVMQDHF SRASSIIDEL FQDRFFTREP
210 220 230 240 250
QDTYHYLPFS LPHRRPHFFF PKSRIVRSLM PFSPYEPLNF HAMFQPFLEM
260 270 280 290 300
IHEAQQAMDI HFHSPAFQHP PTEFIREGDD DRTVCREIRH NSTGCLRMKD
310 320 330 340 350
QCDKCREILS VDCSTNNPSQ AKLRRELDES LQVAERLTRK YNELLKSYQW
360 370 380 390 400
KMLNTSSLLE QLNEQFNWVS RLANLTQGED QYYLRVTTVA SHTSDSDVPS
410 420 430 440
GVTEVVVKLF DSDPITVTVP VEVSRKNPKF METVAEKALQ EYRKKHREE
Note: Major isoform.
Length:449
Mass (Da):52,495
Last modified:July 1, 1989 - v1
Checksum:i9583DE4CCECC169F
GO
Isoform 2 (identifier: P10909-2) [UniParc]FASTAAdd to basket
Also known as: 1, CLU34

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQVCSQPQRGCVREQSAINTAPPSAHNAASPGGARGHRVPLTEACKDSRIGGM

Show »
Length:501
Mass (Da):57,833
Checksum:i1941842E61CD3464
GO
Isoform 3 (identifier: P10909-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-175: Missing.

Show »
Length:274
Mass (Da):32,364
Checksum:i0917960A8B4D6857
GO
Isoform 4 (identifier: P10909-4) [UniParc]FASTAAdd to basket
Also known as: nCLU

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: Missing.

Note: Minor isoform that has been detected in a breast cancer cell line, but not in any other tissues or cell lines.
Show »
Length:416
Mass (Da):48,803
Checksum:i77900AB70F7AC243
GO
Isoform 5 (identifier: P10909-5) [UniParc]FASTAAdd to basket
Also known as: CLU36

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEACKDSRIGGM

Show »
Length:460
Mass (Da):53,643
Checksum:i0B0A0165A6C5622A
GO

Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ETB4E7ETB4_HUMAN
Clusterin
CLU
271Annotation score:
H0YC35H0YC35_HUMAN
Clusterin
CLU
284Annotation score:
H0YLK8H0YLK8_HUMAN
Clusterin
CLU
297Annotation score:
E7ERK6E7ERK6_HUMAN
Clusterin
CLU
204Annotation score:
E5RGB0E5RGB0_HUMAN
Clusterin
CLU
129Annotation score:
E5RJZ5E5RJZ5_HUMAN
Clusterin
CLU
139Annotation score:
E5RH61E5RH61_HUMAN
Clusterin
CLU
135Annotation score:
E5RG36E5RG36_HUMAN
Clusterin
CLU
82Annotation score:
E5RJD6E5RJD6_HUMAN
Clusterin
CLU
32Annotation score:
H0YAS8H0YAS8_HUMAN
Clusterin
CLU
140Annotation score:

Sequence cautioni

The sequence AAA35692 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAB06508 differs from that shown. Contaminating sequence.Curated
The sequence AAB06508 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH10514 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH19588 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAP88927 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAP88927 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAT08041 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAG36598 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAA32847 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti28D → S AA sequence (PubMed:1903064).Curated1
Sequence conflicti28D → S AA sequence (PubMed:3154963).Curated1
Sequence conflicti47Q → H AA sequence (PubMed:2387851).Curated1
Sequence conflicti52G → Q AA sequence (PubMed:2387851).Curated1
Sequence conflicti172M → V in CAI45990 (PubMed:17974005).Curated1
Sequence conflicti224R → L in BAG36598 (PubMed:14702039).Curated1
Sequence conflicti305C → M AA sequence (PubMed:1903064).Curated1
Sequence conflicti388T → M in CAI45990 (PubMed:17974005).Curated1
Sequence conflicti411D → G in BAG36598 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_019366317N → H1 PublicationCorresponds to variant dbSNP:rs9331936Ensembl.1
Natural variantiVAR_019367328D → N1 PublicationCorresponds to variant dbSNP:rs9331938Ensembl.1
Natural variantiVAR_019368396S → L1 PublicationCorresponds to variant dbSNP:rs13494Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0414751 – 175Missing in isoform 3. 1 PublicationAdd BLAST175
Alternative sequenceiVSP_0414761 – 33Missing in isoform 4. CuratedAdd BLAST33
Alternative sequenceiVSP_0376611M → MQVCSQPQRGCVREQSAINT APPSAHNAASPGGARGHRVP LTEACKDSRIGGM in isoform 2. 3 Publications1
Alternative sequenceiVSP_0414771M → MEACKDSRIGGM in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M25915 mRNA Translation: AAA35692.1 Different initiation.
M63379
, M63376, M63377, M63378 Genomic DNA Translation: AAB06507.1
M64722 mRNA Translation: AAB06508.1 Sequence problems.
AK093399 mRNA Translation: BAG52708.1
AK313870 mRNA Translation: BAG36598.1 Different initiation.
CR599675 mRNA No translation available.
BX648414 mRNA Translation: CAI45990.1
AY341244 Genomic DNA Translation: AAP88927.1 Different initiation.
AF311103 Genomic DNA No translation available.
BC010514 mRNA Translation: AAH10514.1 Different initiation.
BC019588 mRNA Translation: AAH19588.1 Different initiation.
BU150467 mRNA No translation available.
J02908 mRNA Translation: AAA51765.1
M74816 mRNA Translation: AAA60321.1
L00974 Genomic DNA Translation: AAA60567.1
X14723 mRNA Translation: CAA32847.1 Different initiation.
AY513288 mRNA Translation: AAT08041.1 Different initiation.
CCDSiCCDS47832.1 [P10909-1]
PIRiS43646 A41386
RefSeqiNP_001822.3, NM_001831.3 [P10909-1]
XP_006716347.1, XM_006716284.2 [P10909-2]
UniGeneiHs.436657

Genome annotation databases

EnsembliENST00000316403; ENSP00000315130; ENSG00000120885 [P10909-1]
ENST00000405140; ENSP00000385419; ENSG00000120885 [P10909-1]
ENST00000523500; ENSP00000429620; ENSG00000120885 [P10909-1]
GeneIDi1191
KEGGihsa:1191
UCSCiuc003xfw.3 human [P10909-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

NIEHS-SNPs
Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M25915 mRNA Translation: AAA35692.1 Different initiation.
M63379
, M63376, M63377, M63378 Genomic DNA Translation: AAB06507.1
M64722 mRNA Translation: AAB06508.1 Sequence problems.
AK093399 mRNA Translation: BAG52708.1
AK313870 mRNA Translation: BAG36598.1 Different initiation.
CR599675 mRNA No translation available.
BX648414 mRNA Translation: CAI45990.1
AY341244 Genomic DNA Translation: AAP88927.1 Different initiation.
AF311103 Genomic DNA No translation available.
BC010514 mRNA Translation: AAH10514.1 Different initiation.
BC019588 mRNA Translation: AAH19588.1 Different initiation.
BU150467 mRNA No translation available.
J02908 mRNA Translation: AAA51765.1
M74816 mRNA Translation: AAA60321.1
L00974 Genomic DNA Translation: AAA60567.1
X14723 mRNA Translation: CAA32847.1 Different initiation.
AY513288 mRNA Translation: AAT08041.1 Different initiation.
CCDSiCCDS47832.1 [P10909-1]
PIRiS43646 A41386
RefSeqiNP_001822.3, NM_001831.3 [P10909-1]
XP_006716347.1, XM_006716284.2 [P10909-2]
UniGeneiHs.436657

3D structure databases

ProteinModelPortaliP10909
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107603, 154 interactors
DIPiDIP-37546N
IntActiP10909, 53 interactors
MINTiP10909
STRINGi9606.ENSP00000315130

PTM databases

CarbonylDBiP10909
GlyConnecti759
iPTMnetiP10909
PhosphoSitePlusiP10909

Polymorphism and mutation databases

BioMutaiCLU
DMDMi116533

2D gel databases

DOSAC-COBS-2DPAGEiP10909
OGPiP10909
REPRODUCTION-2DPAGEiIPI00291262
SWISS-2DPAGEiP10909

Proteomic databases

EPDiP10909
MaxQBiP10909
PaxDbiP10909
PeptideAtlasiP10909
PRIDEiP10909
ProteomicsDBi52663
52664 [P10909-2]
52665 [P10909-3]
52666 [P10909-4]
52667 [P10909-5]

Protocols and materials databases

DNASUi1191
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000316403; ENSP00000315130; ENSG00000120885 [P10909-1]
ENST00000405140; ENSP00000385419; ENSG00000120885 [P10909-1]
ENST00000523500; ENSP00000429620; ENSG00000120885 [P10909-1]
GeneIDi1191
KEGGihsa:1191
UCSCiuc003xfw.3 human [P10909-1]

Organism-specific databases

CTDi1191
DisGeNETi1191
EuPathDBiHostDB:ENSG00000120885.19
GeneCardsiCLU
HGNCiHGNC:2095 CLU
HPAiCAB016253
HPA000572
MIMi185430 gene
neXtProtiNX_P10909
OpenTargetsiENSG00000120885
PharmGKBiPA26620
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IHRB Eukaryota
ENOG410YYKB LUCA
GeneTreeiENSGT00530000063668
HOVERGENiHBG006908
InParanoidiP10909
KOiK17252
OMAiFMETVAE
OrthoDBiEOG091G05R5
PhylomeDBiP10909
TreeFamiTF333030

Enzyme and pathway databases

ReactomeiR-HSA-114608 Platelet degranulation
R-HSA-166665 Terminal pathway of complement
R-HSA-6803157 Antimicrobial peptides
R-HSA-977606 Regulation of Complement cascade
SIGNORiP10909

Miscellaneous databases

ChiTaRSiCLU human
GeneWikiiClusterin
GenomeRNAii1191
PMAP-CutDBiP10909
PROiPR:P10909
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000120885 Expressed in 238 organ(s), highest expression level in tendon of biceps brachii
CleanExiHS_CLU
ExpressionAtlasiP10909 baseline and differential
GenevisibleiP10909 HS

Family and domain databases

InterProiView protein in InterPro
IPR016016 Clusterin
IPR000753 Clusterin-like
IPR016015 Clusterin_C
IPR033986 Clusterin_CS
IPR016014 Clusterin_N
PANTHERiPTHR10970 PTHR10970, 1 hit
PTHR10970:SF1 PTHR10970:SF1, 1 hit
PfamiView protein in Pfam
PF01093 Clusterin, 1 hit
PIRSFiPIRSF002368 Clusterin, 1 hit
SMARTiView protein in SMART
SM00035 CLa, 1 hit
SM00030 CLb, 1 hit
PROSITEiView protein in PROSITE
PS00492 CLUSTERIN_1, 1 hit
PS00493 CLUSTERIN_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCLUS_HUMAN
AccessioniPrimary (citable) accession number: P10909
Secondary accession number(s): B2R9Q1
, B3KSE6, P11380, P11381, Q2TU75, Q5HYC1, Q7Z5B9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: July 1, 1989
Last modified: November 7, 2018
This is version 214 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again