Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcriptional activator Myb

Gene

MYB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi63 – 86H-T-H motifPROSITE-ProRule annotationAdd BLAST24
DNA bindingi115 – 138H-T-H motifPROSITE-ProRule annotationAdd BLAST24
DNA bindingi166 – 189H-T-H motifPROSITE-ProRule annotationAdd BLAST24

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8939236 RUNX1 regulates transcription of genes involved in differentiation of HSCs
R-HSA-9018519 Estrogen-dependent gene expression
R-HSA-983231 Factors involved in megakaryocyte development and platelet production

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P10242

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P10242

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcriptional activator Myb
Alternative name(s):
Proto-oncogene c-Myb
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MYB
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000118513.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7545 MYB

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
189990 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P10242

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNET

More...
DisGeNETi
4602

MalaCards human disease database

More...
MalaCardsi
MYB

Open Targets

More...
OpenTargetsi
ENSG00000118513

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
86849 Acute basophilic leukemia
251671 Angiocentric glioma
99861 Precursor T-cell acute lymphoblastic leukemia

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31345

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MYB

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2815504

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001970481 – 640Transcriptional activator MybAdd BLAST640

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei471N6-acetyllysineCombined sources1
Modified residuei480N6-acetyllysine; alternateCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki480Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei532PhosphoserineCombined sources1
Modified residuei534PhosphothreonineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated; mediated by SIAH1 and leading to its subsequent proteasomal degradation.Curated
Phosphorylated by NLK on multiple sites, which induces proteasomal degradation.By similarity
Phosphorylated by HIPK1. This phosphorylation reduces MYB transcription factor activity but not MYB protein levels.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P10242

PeptideAtlas

More...
PeptideAtlasi
P10242

PRoteomics IDEntifications database

More...
PRIDEi
P10242

ProteomicsDB human proteome resource

More...
ProteomicsDBi
52578
52579 [P10242-2]
52580 [P10242-3]
52581 [P10242-4]
52582 [P10242-5]
52583 [P10242-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P10242

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P10242

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Negatively regulated by microRNA-155 (miR-155).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000118513 Expressed in 123 organ(s), highest expression level in oviduct epithelium

CleanEx database of gene expression profiles

More...
CleanExi
HS_MYB

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P10242 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P10242 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB017704

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds MYBBP1A. Interacts with HIPK2, MAF and NLK (By similarity). Binds to HIPK1.By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110687, 50 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-504 c-Myb-C/EBPbeta complex

Database of interacting proteins

More...
DIPi
DIP-1057N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P10242

Protein interaction database and analysis system

More...
IntActi
P10242, 35 interactors

Molecular INTeraction database

More...
MINTi
P10242

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000339992

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P10242

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P10242

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini35 – 86HTH myb-type 1PROSITE-ProRule annotationAdd BLAST52
Domaini87 – 142HTH myb-type 2PROSITE-ProRule annotationAdd BLAST56
Domaini143 – 193HTH myb-type 3PROSITE-ProRule annotationAdd BLAST51

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni90 – 193Interaction with HIPK2 and NLKBy similarityAdd BLAST104
Regioni275 – 327Transcription activation domain (PubMed:2189102)1 PublicationAdd BLAST53
Regioni328 – 465Negative regulatory domainBy similarityAdd BLAST138
Regioni376 – 397Leucine-zipperAdd BLAST22

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Comprised of 3 domains; an N-terminal DNA-binding domain, a centrally located transcriptional activation domain and a C-terminal domain involved in transcriptional repression.1 Publication

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0048 Eukaryota
COG5147 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156248

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG007964

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P10242

KEGG Orthology (KO)

More...
KOi
K09420

Identification of Orthologs from Complete Genome Data

More...
OMAi
HWEGESL

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0I6P

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P10242

TreeFam database of animal gene trees

More...
TreeFami
TF326257

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00167 SANT, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015395 C-myb_C
IPR009057 Homeobox-like_sf
IPR015495 Myb-like_TF
IPR017930 Myb_dom
IPR001005 SANT/Myb
IPR012642 Tscrpt_reg_Wos2-domain

The PANTHER Classification System

More...
PANTHERi
PTHR10641 PTHR10641, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09316 Cmyb_C, 1 hit
PF07988 LMSTEN, 1 hit
PF00249 Myb_DNA-binding, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00717 SANT, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46689 SSF46689, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51294 HTH_MYB, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (12+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 12 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 12 described isoforms and 22 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P10242-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MARRPRHSIY SSDEDDEDFE MCDHDYDGLL PKSGKRHLGK TRWTREEDEK
60 70 80 90 100
LKKLVEQNGT DDWKVIANYL PNRTDVQCQH RWQKVLNPEL IKGPWTKEED
110 120 130 140 150
QRVIELVQKY GPKRWSVIAK HLKGRIGKQC RERWHNHLNP EVKKTSWTEE
160 170 180 190 200
EDRIIYQAHK RLGNRWAEIA KLLPGRTDNA IKNHWNSTMR RKVEQEGYLQ
210 220 230 240 250
ESSKASQPAV ATSFQKNSHL MGFAQAPPTA QLPATGQPTV NNDYSYYHIS
260 270 280 290 300
EAQNVSSHVP YPVALHVNIV NVPQPAAAAI QRHYNDEDPE KEKRIKELEL
310 320 330 340 350
LLMSTENELK GQQVLPTQNH TCSYPGWHST TIADHTRPHG DSAPVSCLGE
360 370 380 390 400
HHSTPSLPAD PGSLPEESAS PARCMIVHQG TILDNVKNLL EFAETLQFID
410 420 430 440 450
SFLNTSSNHE NSDLEMPSLT STPLIGHKLT VTTPFHRDQT VKTQKENTVF
460 470 480 490 500
RTPAIKRSIL ESSPRTPTPF KHALAAQEIK YGPLKMLPQT PSHLVEDLQD
510 520 530 540 550
VIKQESDESG IVAEFQENGP PLLKKIKQEV ESPTDKSGNF FCSHHWEGDS
560 570 580 590 600
LNTQLFTQTS PVADAPNILT SSVLMAPASE DEDNVLKAFT VPKNRSLASP
610 620 630 640
LQPCSSTWEP ASCGKMEEQM TSSSQARKYV NAFSARTLVM
Length:640
Mass (Da):72,341
Last modified:November 1, 1997 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFD5E6694020426ED
GO
Isoform 2 (identifier: P10242-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     314-316: Missing.

Show »
Length:637
Mass (Da):72,032
Checksum:i75D8144FEEC381C5
GO
Isoform 3 (identifier: P10242-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     317-350: TQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGE → LCGPLLNSDIFSDWAANWDGSLCFATYIVNQQRQ
     351-640: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:350
Mass (Da):40,620
Checksum:i60632631CFEE51FF
GO
Isoform 4 (identifier: P10242-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-401: S → SDSSSWCDLS...VKSLPFSPSQ

Show »
Length:761
Mass (Da):85,475
Checksum:i9D11661393B1A85B
GO
Isoform 5 (identifier: P10242-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     402-402: F → M
     403-640: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:402
Mass (Da):46,065
Checksum:i331FC406EC1C335C
GO
Isoform 6 (identifier: P10242-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     567-640: NILTSSVLMA...NAFSARTLVM → TGVQWHDFGS...LRFNGTSIRR

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:666
Mass (Da):75,526
Checksum:iBF91C8F858EA12DF
GO
Isoform 7 (identifier: P10242-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     314-316: Missing.
     401-401: S → SDSSSWCDLS...VKSLPFSPSQ

Show »
Length:758
Mass (Da):85,166
Checksum:i0F2142F19B9D4E48
GO
Isoform 8 (identifier: P10242-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     386-401: VKNLLEFAETLQFIDS → DSSSWCDLSS...VKSLPFSPSQ

Show »
Length:745
Mass (Da):83,626
Checksum:i9B6C4EBD083ED7CF
GO
Isoform 9 (identifier: P10242-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     282-316: Missing.

Show »
Length:605
Mass (Da):68,135
Checksum:i6078B295869F3BDA
GO
Isoform 10 (identifier: P10242-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     530-566: Missing.

Show »
Length:603
Mass (Da):68,308
Checksum:i560AF3F759C690F1
GO
Isoform 11 (identifier: P10242-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     317-401: Missing.

Show »
Length:555
Mass (Da):63,198
Checksum:iD29BCA8DD3CDA8FE
GO
Isoform 12 (identifier: P10242-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     317-640: TQNHTCSYPG...NAFSARTLVM → VRLSSCA

Note: No experimental confirmation available.
Show »
Length:323
Mass (Da):37,507
Checksum:i52D7B7EA3EDB98E1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 22 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PQQ2E9PQQ2_HUMAN
Transcriptional activator Myb
MYB
581Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PJF1E9PJF1_HUMAN
Transcriptional activator Myb
MYB
581Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q708E3Q708E3_HUMAN
C-myb v-myb myeloblastosis viral on...
MYB c-myb, hCG_32380
449Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q708E1Q708E1_HUMAN
C-myb v-myb myeloblastosis viral on...
MYB c-myb, hCG_32380
612Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PLN0E9PLN0_HUMAN
Transcriptional activator Myb
MYB
611Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PNH6E9PNH6_HUMAN
Transcriptional activator Myb
MYB
419Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PIW4E9PIW4_HUMAN
Transcriptional activator Myb
MYB
385Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PN43E9PN43_HUMAN
Transcriptional activator Myb
MYB
422Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PJ96E9PJ96_HUMAN
Transcriptional activator Myb
MYB
364Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKZ3E9PKZ3_HUMAN
Transcriptional activator Myb
MYB
446Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti511I → F in AAA52032 (PubMed:3540945).Curated1
Sequence conflicti511I → F in AY787447 (Ref. 6) Curated1
Sequence conflicti511I → F in AY787448 (Ref. 6) Curated1
Sequence conflicti563A → R in AAA52032 (PubMed:3540945).Curated1
Sequence conflicti563A → R in AY787447 (Ref. 6) Curated1
Sequence conflicti563A → R in AY787448 (Ref. 6) Curated1
Isoform 4 (identifier: P10242-4)
Sequence conflicti433L → F in CAA35503 (Ref. 8) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_050188336T → I. Corresponds to variant dbSNP:rs2229999Ensembl.1
Natural variantiVAR_050189422T → N. Corresponds to variant dbSNP:rs2230000Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_046658282 – 316Missing in isoform 9. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_003293314 – 316Missing in isoform 2 and isoform 7. 3 Publications3
Alternative sequenceiVSP_053389317 – 640TQNHT…RTLVM → VRLSSCA in isoform 12. 1 PublicationAdd BLAST324
Alternative sequenceiVSP_046659317 – 401Missing in isoform 11. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_003294317 – 350TQNHT…SCLGE → LCGPLLNSDIFSDWAANWDG SLCFATYIVNQQRQ in isoform 3. CuratedAdd BLAST34
Alternative sequenceiVSP_003295351 – 640Missing in isoform 3. CuratedAdd BLAST290
Alternative sequenceiVSP_046660386 – 401VKNLL…QFIDS → DSSSWCDLSSFEFFEEADFS PSQHHTGKALQLQQREGNGT KPAGEPSPRVNKRMLSESSL DPPKVLPPARHSTIPLVILR KKRGQASPLATGDCSSFIFA DVSSSTPKRSPVKSLPFSPS Q in isoform 8. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_003296401S → SDSSSWCDLSSFEFFEEADF SPSQHHTGKALQLQQREGNG TKPAGEPSPRVNKRMLSESS LDPPKVLPPARHSTIPLVIL RKKRGQASPLATGDCSSFIF ADVSSSTPKRSPVKSLPFSP SQ in isoform 4 and isoform 7. 2 Publications1
Alternative sequenceiVSP_003297402F → M in isoform 5. Curated1
Alternative sequenceiVSP_003298403 – 640Missing in isoform 5. CuratedAdd BLAST238
Alternative sequenceiVSP_046661530 – 566Missing in isoform 10. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_003299567 – 640NILTS…RTLVM → TGVQWHDFGSLQPLPPGFKR FSCLSLPRSWDYRHPPPRPA NFEFLVETGFLHVGQAGLEL LTSGDLPASASQSARITGVS HRARPEYSYKLRFNGTSIRR in isoform 6. CuratedAdd BLAST74

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M15024 mRNA Translation: AAA52032.1
X52125 mRNA Translation: CAA36371.1
AJ606319 mRNA Translation: CAE55170.1
AJ606320 mRNA Translation: CAE55171.1
AJ616791 mRNA Translation: CAF04482.1
AJ616791 mRNA Translation: CAF04479.1
U22376 Genomic DNA Translation: AAB49034.1
U22376 Genomic DNA Translation: AAB49035.1
U22376 Genomic DNA Translation: AAB49036.1
U22376 Genomic DNA Translation: AAB49037.1
U22376 Genomic DNA Translation: AAB49038.1
U22376 Genomic DNA Translation: AAB49039.1
AF104863 mRNA Translation: AAC96326.1
AY787443 mRNA No translation available.
AY787447 mRNA No translation available.
AY787448 mRNA No translation available.
AY787461 mRNA No translation available.
AY787468 mRNA No translation available.
AL023693 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW47969.1
CH471051 Genomic DNA Translation: EAW47973.1
BC064955 mRNA Translation: AAH64955.1
M13665 mRNA Translation: AAA52030.1
M13666 mRNA Translation: AAA52031.1
X17469 mRNA Translation: CAA35503.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47481.1 [P10242-4]
CCDS47482.1 [P10242-2]
CCDS5174.1 [P10242-1]
CCDS55058.1 [P10242-7]
CCDS55059.1 [P10242-8]
CCDS55060.1 [P10242-10]
CCDS55061.1 [P10242-11]
CCDS55062.1 [P10242-9]

Protein sequence database of the Protein Information Resource

More...
PIRi
A26661 TVHUMB

NCBI Reference Sequences

More...
RefSeqi
NP_001123644.1, NM_001130172.1 [P10242-2]
NP_001123645.1, NM_001130173.1 [P10242-4]
NP_001155128.1, NM_001161656.1 [P10242-7]
NP_001155129.1, NM_001161657.1 [P10242-11]
NP_001155130.1, NM_001161658.1 [P10242-8]
NP_001155131.1, NM_001161659.1 [P10242-10]
NP_001155132.1, NM_001161660.1 [P10242-9]
NP_005366.2, NM_005375.3 [P10242-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.606320
Hs.626299

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000341911; ENSP00000339992; ENSG00000118513 [P10242-4]
ENST00000367812; ENSP00000356786; ENSG00000118513 [P10242-6]
ENST00000367814; ENSP00000356788; ENSG00000118513 [P10242-1]
ENST00000442647; ENSP00000410825; ENSG00000118513 [P10242-2]
ENST00000525369; ENSP00000435938; ENSG00000118513 [P10242-11]
ENST00000525477; ENSP00000437081; ENSG00000118513 [P10242-3]
ENST00000525514; ENSP00000435578; ENSG00000118513 [P10242-3]
ENST00000528774; ENSP00000434723; ENSG00000118513 [P10242-7]
ENST00000529586; ENSP00000437264; ENSG00000118513 [P10242-3]
ENST00000533384; ENSP00000432811; ENSG00000118513 [P10242-5]
ENST00000533624; ENSP00000436605; ENSG00000118513 [P10242-9]
ENST00000533808; ENSP00000435293; ENSG00000118513 [P10242-5]
ENST00000533837; ENSP00000434639; ENSG00000118513 [P10242-5]
ENST00000534044; ENSP00000435055; ENSG00000118513 [P10242-10]
ENST00000534121; ENSP00000432851; ENSG00000118513 [P10242-8]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4602

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4602

UCSC genome browser

More...
UCSCi
uc003qfh.4 human [P10242-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M15024 mRNA Translation: AAA52032.1
X52125 mRNA Translation: CAA36371.1
AJ606319 mRNA Translation: CAE55170.1
AJ606320 mRNA Translation: CAE55171.1
AJ616791 mRNA Translation: CAF04482.1
AJ616791 mRNA Translation: CAF04479.1
U22376 Genomic DNA Translation: AAB49034.1
U22376 Genomic DNA Translation: AAB49035.1
U22376 Genomic DNA Translation: AAB49036.1
U22376 Genomic DNA Translation: AAB49037.1
U22376 Genomic DNA Translation: AAB49038.1
U22376 Genomic DNA Translation: AAB49039.1
AF104863 mRNA Translation: AAC96326.1
AY787443 mRNA No translation available.
AY787447 mRNA No translation available.
AY787448 mRNA No translation available.
AY787461 mRNA No translation available.
AY787468 mRNA No translation available.
AL023693 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW47969.1
CH471051 Genomic DNA Translation: EAW47973.1
BC064955 mRNA Translation: AAH64955.1
M13665 mRNA Translation: AAA52030.1
M13666 mRNA Translation: AAA52031.1
X17469 mRNA Translation: CAA35503.1
CCDSiCCDS47481.1 [P10242-4]
CCDS47482.1 [P10242-2]
CCDS5174.1 [P10242-1]
CCDS55058.1 [P10242-7]
CCDS55059.1 [P10242-8]
CCDS55060.1 [P10242-10]
CCDS55061.1 [P10242-11]
CCDS55062.1 [P10242-9]
PIRiA26661 TVHUMB
RefSeqiNP_001123644.1, NM_001130172.1 [P10242-2]
NP_001123645.1, NM_001130173.1 [P10242-4]
NP_001155128.1, NM_001161656.1 [P10242-7]
NP_001155129.1, NM_001161657.1 [P10242-11]
NP_001155130.1, NM_001161658.1 [P10242-8]
NP_001155131.1, NM_001161659.1 [P10242-10]
NP_001155132.1, NM_001161660.1 [P10242-9]
NP_005366.2, NM_005375.3 [P10242-1]
UniGeneiHs.606320
Hs.626299

3D structure databases

ProteinModelPortaliP10242
SMRiP10242
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110687, 50 interactors
ComplexPortaliCPX-504 c-Myb-C/EBPbeta complex
DIPiDIP-1057N
ELMiP10242
IntActiP10242, 35 interactors
MINTiP10242
STRINGi9606.ENSP00000339992

PTM databases

iPTMnetiP10242
PhosphoSitePlusiP10242

Polymorphism and mutation databases

BioMutaiMYB
DMDMi2815504

Proteomic databases

PaxDbiP10242
PeptideAtlasiP10242
PRIDEiP10242
ProteomicsDBi52578
52579 [P10242-2]
52580 [P10242-3]
52581 [P10242-4]
52582 [P10242-5]
52583 [P10242-6]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4602
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341911; ENSP00000339992; ENSG00000118513 [P10242-4]
ENST00000367812; ENSP00000356786; ENSG00000118513 [P10242-6]
ENST00000367814; ENSP00000356788; ENSG00000118513 [P10242-1]
ENST00000442647; ENSP00000410825; ENSG00000118513 [P10242-2]
ENST00000525369; ENSP00000435938; ENSG00000118513 [P10242-11]
ENST00000525477; ENSP00000437081; ENSG00000118513 [P10242-3]
ENST00000525514; ENSP00000435578; ENSG00000118513 [P10242-3]
ENST00000528774; ENSP00000434723; ENSG00000118513 [P10242-7]
ENST00000529586; ENSP00000437264; ENSG00000118513 [P10242-3]
ENST00000533384; ENSP00000432811; ENSG00000118513 [P10242-5]
ENST00000533624; ENSP00000436605; ENSG00000118513 [P10242-9]
ENST00000533808; ENSP00000435293; ENSG00000118513 [P10242-5]
ENST00000533837; ENSP00000434639; ENSG00000118513 [P10242-5]
ENST00000534044; ENSP00000435055; ENSG00000118513 [P10242-10]
ENST00000534121; ENSP00000432851; ENSG00000118513 [P10242-8]
GeneIDi4602
KEGGihsa:4602
UCSCiuc003qfh.4 human [P10242-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4602
DisGeNETi4602
EuPathDBiHostDB:ENSG00000118513.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MYB
HGNCiHGNC:7545 MYB
HPAiCAB017704
MalaCardsiMYB
MIMi189990 gene
neXtProtiNX_P10242
OpenTargetsiENSG00000118513
Orphaneti86849 Acute basophilic leukemia
251671 Angiocentric glioma
99861 Precursor T-cell acute lymphoblastic leukemia
PharmGKBiPA31345

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0048 Eukaryota
COG5147 LUCA
GeneTreeiENSGT00940000156248
HOVERGENiHBG007964
InParanoidiP10242
KOiK09420
OMAiHWEGESL
OrthoDBiEOG091G0I6P
PhylomeDBiP10242
TreeFamiTF326257

Enzyme and pathway databases

ReactomeiR-HSA-8939236 RUNX1 regulates transcription of genes involved in differentiation of HSCs
R-HSA-9018519 Estrogen-dependent gene expression
R-HSA-983231 Factors involved in megakaryocyte development and platelet production
SignaLinkiP10242
SIGNORiP10242

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MYB human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MYB_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4602

Protein Ontology

More...
PROi
PR:P10242

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000118513 Expressed in 123 organ(s), highest expression level in oviduct epithelium
CleanExiHS_MYB
ExpressionAtlasiP10242 baseline and differential
GenevisibleiP10242 HS

Family and domain databases

CDDicd00167 SANT, 3 hits
InterProiView protein in InterPro
IPR015395 C-myb_C
IPR009057 Homeobox-like_sf
IPR015495 Myb-like_TF
IPR017930 Myb_dom
IPR001005 SANT/Myb
IPR012642 Tscrpt_reg_Wos2-domain
PANTHERiPTHR10641 PTHR10641, 2 hits
PfamiView protein in Pfam
PF09316 Cmyb_C, 1 hit
PF07988 LMSTEN, 1 hit
PF00249 Myb_DNA-binding, 3 hits
SMARTiView protein in SMART
SM00717 SANT, 3 hits
SUPFAMiSSF46689 SSF46689, 2 hits
PROSITEiView protein in PROSITE
PS51294 HTH_MYB, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMYB_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P10242
Secondary accession number(s): E9PI07
, E9PLZ5, E9PNA4, E9PNL6, E9PRS2, P78391, P78392, P78525, P78526, Q14023, Q14024, Q708E4, Q708E7, Q9UE83
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: November 1, 1997
Last modified: December 5, 2018
This is version 191 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again