Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P10078 (ZFP28_MOUSE)

Entry version 184 (13 Feb 2019)
Sequence version 3 (04 Aug 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Zinc finger protein 28

Gene

Zfp28

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation. May have a role in embryonic development.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri377 – 399C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri405 – 427C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri433 – 456C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri462 – 484C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri490 – 512C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri518 – 540C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri546 – 568C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri574 – 596C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri602 – 624C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri630 – 652C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri658 – 680C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri686 – 708C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri714 – 736C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri742 – 764C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri770 – 792C2H2-type 15; degeneratePROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-212436 Generic Transcription Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 28
Short name:
Zfp-28
Alternative name(s):
Protein mKR5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Zfp28
Synonyms:Mkr5, Zfp-28
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:99175 Zfp28

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000472901 – 825Zinc finger protein 28Add BLAST825

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P10078

MaxQB - The MaxQuant DataBase

More...MaxQBi		P10078

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P10078

PRoteomics IDEntifications database

More...PRIDEi		P10078

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P10078

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P10078

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed predominantly in ovary.

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expression decreases in embryo after day 16.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000062861 Expressed in 188 organ(s), highest expression level in oocyte

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P10078 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P10078 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		204654, 1 interactor

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000079812

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		P10078

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P10078

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini103 – 174KRABPROSITE-ProRule annotationAdd BLAST72

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the krueppel C2H2-type zinc-finger protein family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri377 – 399C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri405 – 427C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri433 – 456C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri462 – 484C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri490 – 512C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri518 – 540C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri546 – 568C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri574 – 596C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri602 – 624C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri630 – 652C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri658 – 680C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri686 – 708C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri714 – 736C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri742 – 764C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri770 – 792C2H2-type 15; degeneratePROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000162376

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG018163

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P10078

KEGG Orthology (KO)

More...KOi		K09228

Identification of Orthologs from Complete Genome Data

More...OMAi		TGIYAGK

Database of Orthologous Groups

More...OrthoDBi		1318335at2759

TreeFam database of animal gene trees

More...TreeFami		TF341817

Family and domain databases

Conserved Domains Database

More...CDDi		cd07765 KRAB_A-box, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 11 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 14 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 8 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 14 hits
PS50157 ZINC_FINGER_C2H2_2, 14 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P10078-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQGMASVVSC EPWALLGRGA LCTKARPGGG PAAGTVVAPG SPDRGRPRSR 
        60         70         80         90        100
NSLASQDQQG AVTSGTAHKA LFSRDTNFLQ EINRKQEAAP TGTRHKAKSQ 
       110        120        130        140        150
GLVTFGDVAV VFSQEEWEWL NSEQRSLYWK VMLDNYRNLA SLGLCASQPD 
       160        170        180        190        200
MITSLEQGRD PWMMKRKMRK GQHLDLKAMQ ETKEFPPKDL SEETLFLAVL 
       210        220        230        240        250
RKQLLPHRPK CSMVRAAWEG GAVFTTHRGL KTNSGLARDS PAQLVSAQRS 
       260        270        280        290        300
FCKSVTWENC GDRGSVGQQS VQEAQDLLPR QDSHAERVTG RTWSTKLECS 
       310        320        330        340        350
TFRDQDSECT FERNEQETVT PNRAFSEGRD GMCIESGRWF HLNSSDERSH 
       360        370        380        390        400
NCDSGKSFSS NPVVVKETGI CSGKKLFQCN ECKKTFTQSS SLTVHQRIHT 
       410        420        430        440        450
GEKPYKCNQC GKAFSDGSSF ARHQRCHTGK KPYECPECGK AFIQNTSLVR 
       460        470        480        490        500
HWRYYHTGEK PFDCIDCGKA FSDHIGLNQH RRIHTGEKPY TCEVCHKSFR 
       510        520        530        540        550
YGSSLTVHQR IHTGEKPYEC EICRKAFSHH ASLTQHQRVH SGEKPFKCKE 
       560        570        580        590        600
CGKAFRQNIH LASHWRIHTG EKPFECGECG KSFSISSQLA THQRIHTGEK 
       610        620        630        640        650
PYECKVCRKA FTQKAHLAQH QKTHTGEKPY ECKECGKAFS QTTHLIQHQR 
       660        670        680        690        700
VHTGEKPYKC LECGKAFGDN SSCTQHRRLH TGQRPYECVE CGKTFKTKSS 
       710        720        730        740        750
LICHRRCHTG EKPYECSACG KAFSHRQSLS VHQRIHSGKK PYECKECRKT 
       760        770        780        790        800
FIQIGHLNQH KRVHTGERTY NYKKGRRAFR QTAHFAHHQQ IHSGKSPAHH 
       810        820 
SLPSTSNPVD LFSKFVWNPS SLPSS
Length:825
Mass (Da):93,309
Last modified:August 4, 2003 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i19BABAC25F2908E6
GO
Isoform 2 (identifier: P10078-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     600-600: K → KPFECKVCRKAFRQNIHLASHWRIHTGEKPFECGECGKSFSISSQLATHQRIHTGEK

Note: No experimental confirmation available.
Show »
Length:881
Mass (Da):99,745
Checksum:i79243B47C9F89C71
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A140LJ19A0A140LJ19_MOUSE
Zinc finger protein 28
Zfp28
161Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140LIA3A0A140LIA3_MOUSE
Zinc finger protein 28
Zfp28
171Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140LIS3A0A140LIS3_MOUSE
Zinc finger protein 28
Zfp28
30Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140LIZ0A0A140LIZ0_MOUSE
Zinc finger protein 28
Zfp28
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140LJB6A0A140LJB6_MOUSE
Zinc finger protein 28
Zfp28
56Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti263R → W in BAC33362 (PubMed:16141072).Curated1
Sequence conflicti426C → Y in CAA31107 (PubMed:3143103).Curated1
Sequence conflicti426C → Y in AAA37120 (PubMed:3143103).Curated1
Sequence conflicti677R → Q (PubMed:3143103).Curated1
Sequence conflicti677R → Q (PubMed:7958967).Curated1
Sequence conflicti683Q → L (PubMed:3143103).Curated1
Sequence conflicti683Q → L (PubMed:7958967).Curated1
Sequence conflicti704 – 705HR → YC (PubMed:3143103).Curated2
Sequence conflicti704 – 705HR → YC (PubMed:7958967).Curated2
Sequence conflicti726R → W (PubMed:3143103).Curated1
Sequence conflicti726R → W (PubMed:7958967).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti658Y → I in strain: 129/Sv; requires 2 nucleotide substitutions. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_006882600K → KPFECKVCRKAFRQNIHLAS HWRIHTGEKPFECGECGKSF SISSQLATHQRIHTGEK in isoform 2. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK028202 mRNA Translation: BAC25810.1
AK048530 mRNA Translation: BAC33362.1
BC062116 mRNA Translation: AAH62116.1
X12594 mRNA Translation: CAA31107.1
M36516 mRNA Translation: AAA37120.1
L28802 Genomic DNA Translation: AAA64428.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS39752.1 [P10078-1]

Protein sequence database of the Protein Information Resource

More...PIRi		I53859

NCBI Reference Sequences

More...RefSeqi		NP_780456.2, NM_175247.3 [P10078-1]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Mm.127014

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000081022; ENSMUSP00000079812; ENSMUSG00000062861 [P10078-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		22690

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:22690

UCSC genome browser

More...UCSCi		uc009fbi.1 mouse [P10078-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028202 mRNA Translation: BAC25810.1
AK048530 mRNA Translation: BAC33362.1
BC062116 mRNA Translation: AAH62116.1
X12594 mRNA Translation: CAA31107.1
M36516 mRNA Translation: AAA37120.1
L28802 Genomic DNA Translation: AAA64428.1
CCDSiCCDS39752.1 [P10078-1]
PIRiI53859
RefSeqiNP_780456.2, NM_175247.3 [P10078-1]
UniGeneiMm.127014

3D structure databases

ProteinModelPortaliP10078
SMRiP10078
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204654, 1 interactor
STRINGi10090.ENSMUSP00000079812

PTM databases

iPTMnetiP10078
PhosphoSitePlusiP10078

Proteomic databases

jPOSTiP10078
MaxQBiP10078
PaxDbiP10078
PRIDEiP10078

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000081022; ENSMUSP00000079812; ENSMUSG00000062861 [P10078-1]
GeneIDi22690
KEGGimmu:22690
UCSCiuc009fbi.1 mouse [P10078-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		140612
MGIiMGI:99175 Zfp28

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000162376
HOVERGENiHBG018163
InParanoidiP10078
KOiK09228
OMAiTGIYAGK
OrthoDBi1318335at2759
TreeFamiTF341817

Enzyme and pathway databases

ReactomeiR-MMU-212436 Generic Transcription Pathway

Miscellaneous databases

Protein Ontology

More...PROi		PR:P10078

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000062861 Expressed in 188 organ(s), highest expression level in oocyte
ExpressionAtlasiP10078 baseline and differential
GenevisibleiP10078 MM

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 11 hits
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 14 hits
SUPFAMiSSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 8 hits
PROSITEiView protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 14 hits
PS50157 ZINC_FINGER_C2H2_2, 14 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZFP28_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P10078
Secondary accession number(s): Q61776, Q8BT11, Q8C836
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: August 4, 2003
Last modified: February 13, 2019
This is version 184 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again