Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 215 (26 Feb 2020)
Sequence version 3 (21 Jun 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein crumbs

Gene

crb

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a central role in cell polarity establishment (PubMed:2344615, PubMed:12900452, PubMed:10102271, PubMed:11740560). Participates in the assembly, positioning and maintenance of adherens junctions via its interaction with the SAC complex (PubMed:11740560, PubMed:12900452, PubMed:10102271, PubMed:11076972). Controls the coalescence of the spots of zonula adherens (ZA) into a adhesive ring around the cells (PubMed:11740560). It may act as a signal (PubMed:2344615). Involved in morphogenesis of the photoreceptor rhabdomere, for positioning and growth of rhabdomere and AJ during the crucial period of photoreceptor extension along the proximodistal axis of the retina (PubMed:12900452). Component of the crb-galla-Xpd (CGX) complex which is essential for proper mitotic chromosome segregation in early embryos (PubMed:25065591). The CGX complex is also required for cell proliferation in developing wing disks (PubMed:25065591). In the CGX complex, acts with galla-1 or galla-2 to recruit Xpd and thus form the functional complex. Together with apn, plays a key role in trachea development at larval stages (PubMed:30645584).7 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processCell cycle, Cell division, Differentiation, Mitosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-1912420 Pre-NOTCH Processing in Golgi
R-DME-9013700 NOTCH4 Activation and Transmission of Signal to the Nucleus
R-DME-9604323 Negative regulation of NOTCH4 signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P10040

Protein family/group databases

Transport Classification Database

More...
TCDBi
9.B.87.1.11 the selenoprotein p receptor (selp-receptor) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein crumbs
Alternative name(s):
95F
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:crb
ORF Names:CG6383
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0259685 crb

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini89 – 2082ExtracellularSequence analysisAdd BLAST1994
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei2083 – 2109HelicalSequence analysisAdd BLAST27
Topological domaini2110 – 2146CytoplasmicSequence analysisAdd BLAST37

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Flies show severe disruptions in the organization of ectodermally derived epithelia and leading in some cases to cell death in these tissues (PubMed:2344615). RNAi-mediated knockdown in the whole body or tracheae results in depletion of its binding partner sdt, twisted tracheal tubes, lack of gas filling and reduced apical surfaces of tracheal tube cells with death occurring at larval stage 2 or 3 (PubMed:30645584). RNAi-mediated knockdown in germline cells results in severe chromosomal and spindle microtubule defects such as chromosome bridges, bent chromosomes, monopolar spindles and fusion with one or more neighboring spindles (PubMed:25065591).3 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 88Add BLAST88
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000749989 – 2146Protein crumbsAdd BLAST2058

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi94N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi196N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi236N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi237N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi269 ↔ 280PROSITE-ProRule annotation
Disulfide bondi274 ↔ 289PROSITE-ProRule annotation
Disulfide bondi291 ↔ 300PROSITE-ProRule annotation
Disulfide bondi308 ↔ 319PROSITE-ProRule annotation
Disulfide bondi313 ↔ 329PROSITE-ProRule annotation
Disulfide bondi331 ↔ 340PROSITE-ProRule annotation
Glycosylationi334N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi350 ↔ 361PROSITE-ProRule annotation
Disulfide bondi355 ↔ 372PROSITE-ProRule annotation
Disulfide bondi374 ↔ 383PROSITE-ProRule annotation
Disulfide bondi390 ↔ 401PROSITE-ProRule annotation
Disulfide bondi395 ↔ 410PROSITE-ProRule annotation
Glycosylationi398N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi412 ↔ 422PROSITE-ProRule annotation
Disulfide bondi429 ↔ 440PROSITE-ProRule annotation
Disulfide bondi434 ↔ 449PROSITE-ProRule annotation
Disulfide bondi451 ↔ 460PROSITE-ProRule annotation
Disulfide bondi466 ↔ 477PROSITE-ProRule annotation
Disulfide bondi471 ↔ 486PROSITE-ProRule annotation
Disulfide bondi488 ↔ 497PROSITE-ProRule annotation
Disulfide bondi547 ↔ 560PROSITE-ProRule annotation
Glycosylationi548N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi554 ↔ 567PROSITE-ProRule annotation
Glycosylationi563N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi569 ↔ 578PROSITE-ProRule annotation
Disulfide bondi611 ↔ 622PROSITE-ProRule annotation
Disulfide bondi616 ↔ 632PROSITE-ProRule annotation
Disulfide bondi634 ↔ 643PROSITE-ProRule annotation
Disulfide bondi650 ↔ 662PROSITE-ProRule annotation
Disulfide bondi657 ↔ 671PROSITE-ProRule annotation
Disulfide bondi673 ↔ 682PROSITE-ProRule annotation
Disulfide bondi689 ↔ 700PROSITE-ProRule annotation
Disulfide bondi694 ↔ 709PROSITE-ProRule annotation
Disulfide bondi711 ↔ 720PROSITE-ProRule annotation
Disulfide bondi727 ↔ 738PROSITE-ProRule annotation
Disulfide bondi732 ↔ 747PROSITE-ProRule annotation
Glycosylationi734N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi744N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi749 ↔ 758PROSITE-ProRule annotation
Disulfide bondi765 ↔ 776PROSITE-ProRule annotation
Disulfide bondi770 ↔ 785PROSITE-ProRule annotation
Disulfide bondi787 ↔ 797PROSITE-ProRule annotation
Disulfide bondi804 ↔ 815PROSITE-ProRule annotation
Disulfide bondi809 ↔ 824PROSITE-ProRule annotation
Disulfide bondi826 ↔ 835PROSITE-ProRule annotation
Disulfide bondi842 ↔ 853PROSITE-ProRule annotation
Disulfide bondi847 ↔ 888PROSITE-ProRule annotation
Glycosylationi858N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi882N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi890 ↔ 899PROSITE-ProRule annotation
Disulfide bondi906 ↔ 917PROSITE-ProRule annotation
Disulfide bondi911 ↔ 926PROSITE-ProRule annotation
Disulfide bondi928 ↔ 937PROSITE-ProRule annotation
Disulfide bondi944 ↔ 955PROSITE-ProRule annotation
Disulfide bondi950 ↔ 964PROSITE-ProRule annotation
Disulfide bondi966 ↔ 975PROSITE-ProRule annotation
Glycosylationi974N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi982 ↔ 993PROSITE-ProRule annotation
Disulfide bondi987 ↔ 1007PROSITE-ProRule annotation
Glycosylationi1006N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1009 ↔ 1018PROSITE-ProRule annotation
Glycosylationi1100N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi1112N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1136N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1171 ↔ 1203PROSITE-ProRule annotation
Glycosylationi1190N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1209 ↔ 1220PROSITE-ProRule annotation
Disulfide bondi1214 ↔ 1229PROSITE-ProRule annotation
Disulfide bondi1231 ↔ 1240PROSITE-ProRule annotation
Glycosylationi1243N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1253N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1352N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1361N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1439N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1452N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1483 ↔ 1494PROSITE-ProRule annotation
Disulfide bondi1488 ↔ 1503PROSITE-ProRule annotation
Disulfide bondi1505 ↔ 1514PROSITE-ProRule annotation
Glycosylationi1543N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1713 ↔ 1757PROSITE-ProRule annotation
Glycosylationi1737N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1749N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1760 ↔ 1771PROSITE-ProRule annotation
Disulfide bondi1765 ↔ 1780PROSITE-ProRule annotation
Disulfide bondi1782 ↔ 1791PROSITE-ProRule annotation
Disulfide bondi1798 ↔ 1809PROSITE-ProRule annotation
Disulfide bondi1803 ↔ 1818PROSITE-ProRule annotation
Glycosylationi1806N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1820 ↔ 1829PROSITE-ProRule annotation
Disulfide bondi1836 ↔ 1847PROSITE-ProRule annotation
Disulfide bondi1841 ↔ 1856PROSITE-ProRule annotation
Glycosylationi1846N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1858 ↔ 1867PROSITE-ProRule annotation
Disulfide bondi1875 ↔ 1886PROSITE-ProRule annotation
Disulfide bondi1880 ↔ 1900PROSITE-ProRule annotation
Glycosylationi1882N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1891N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1897N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1916 ↔ 1927PROSITE-ProRule annotation
Disulfide bondi1921 ↔ 1936PROSITE-ProRule annotation
Disulfide bondi1938 ↔ 1947PROSITE-ProRule annotation
Disulfide bondi1954 ↔ 1965PROSITE-ProRule annotation
Disulfide bondi1959 ↔ 1974PROSITE-ProRule annotation
Disulfide bondi1976 ↔ 1986PROSITE-ProRule annotation
Disulfide bondi1993 ↔ 2006PROSITE-ProRule annotation
Disulfide bondi2000 ↔ 2015PROSITE-ProRule annotation
Disulfide bondi2017 ↔ 2026PROSITE-ProRule annotation
Glycosylationi2027N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi2032 ↔ 2044PROSITE-ProRule annotation
Glycosylationi2033N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi2038 ↔ 2056PROSITE-ProRule annotation
Disulfide bondi2058 ↔ 2067PROSITE-ProRule annotation
Glycosylationi2066N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated in the cytoplasmic domain.Curated

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P10040

PRoteomics IDEntifications database

More...
PRIDEi
P10040

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P10040

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in the larval trachea (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0259685 Expressed in embryo and 32 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P10040 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P10040 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the SAC complex, a complex composed of crb, Patj and sdt (PubMed:11740560, PubMed:10102271, PubMed:11076972). May interact with the par-6 complex, which is composed of par-6, baz and aPKC, via its interaction with Patj (PubMed:12900452, PubMed:10102271, PubMed:11076972).

Interacts with other proteins with Patj and sdt via its short cytoplasmic tail (PubMed:11740560).

Component of the CGX complex composed of crb, galla (galla-1 or galla-2) and Xpd (PubMed:25065591). Able to interact independently (via intracellular domain) with galla-1, galla-2 and Xpd (PubMed:25065591).

Interacts with apn (PubMed:30645584).

6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
67824, 56 interactors

Database of interacting proteins

More...
DIPi
DIP-40915N

Protein interaction database and analysis system

More...
IntActi
P10040, 9 interactors

Molecular INTeraction database

More...
MINTi
P10040

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

12146
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P10040

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini265 – 301EGF-like 1PROSITE-ProRule annotationAdd BLAST37
Domaini304 – 341EGF-like 2PROSITE-ProRule annotationAdd BLAST38
Domaini346 – 384EGF-like 3PROSITE-ProRule annotationAdd BLAST39
Domaini386 – 423EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd BLAST38
Domaini425 – 461EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd BLAST37
Domaini462 – 498EGF-like 6PROSITE-ProRule annotationAdd BLAST37
Domaini543 – 579EGF-like 7PROSITE-ProRule annotationAdd BLAST37
Domaini609 – 644EGF-like 8PROSITE-ProRule annotationAdd BLAST36
Domaini646 – 683EGF-like 9; calcium-bindingPROSITE-ProRule annotationAdd BLAST38
Domaini685 – 721EGF-like 10; calcium-bindingPROSITE-ProRule annotationAdd BLAST37
Domaini723 – 759EGF-like 11; calcium-bindingPROSITE-ProRule annotationAdd BLAST37
Domaini761 – 798EGF-like 12; calcium-bindingPROSITE-ProRule annotationAdd BLAST38
Domaini800 – 836EGF-like 13; calcium-bindingPROSITE-ProRule annotationAdd BLAST37
Domaini838 – 900EGF-like 14PROSITE-ProRule annotationAdd BLAST63
Domaini902 – 938EGF-like 15; calcium-bindingPROSITE-ProRule annotationAdd BLAST37
Domaini940 – 976EGF-like 16; calcium-bindingPROSITE-ProRule annotationAdd BLAST37
Domaini978 – 1019EGF-like 17PROSITE-ProRule annotationAdd BLAST42
Domaini1021 – 1203Laminin G-like 1PROSITE-ProRule annotationAdd BLAST183
Domaini1205 – 1241EGF-like 18PROSITE-ProRule annotationAdd BLAST37
Domaini1248 – 1483Laminin G-like 2PROSITE-ProRule annotationAdd BLAST236
Domaini1479 – 1515EGF-like 19PROSITE-ProRule annotationAdd BLAST37
Domaini1555 – 1757Laminin G-like 3PROSITE-ProRule annotationAdd BLAST203
Domaini1758 – 1792EGF-like 20PROSITE-ProRule annotationAdd BLAST35
Domaini1794 – 1830EGF-like 21; calcium-bindingPROSITE-ProRule annotationAdd BLAST37
Domaini1832 – 1868EGF-like 22; calcium-bindingPROSITE-ProRule annotationAdd BLAST37
Domaini1871 – 1909EGF-like 23PROSITE-ProRule annotationAdd BLAST39
Domaini1912 – 1948EGF-like 24PROSITE-ProRule annotationAdd BLAST37
Domaini1950 – 1987EGF-like 25; calcium-bindingPROSITE-ProRule annotationAdd BLAST38
Domaini1989 – 2027EGF-like 26; calcium-bindingPROSITE-ProRule annotationAdd BLAST39
Domaini2028 – 2068EGF-like 27PROSITE-ProRule annotationAdd BLAST41

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Crumbs protein family.Curated

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1217 Eukaryota
ENOG410XP6K LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000827_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P10040

KEGG Orthology (KO)

More...
KOi
K16681

Identification of Orthologs from Complete Genome Data

More...
OMAi
YDIQFRF

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P10040

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013320 ConA-like_dom_sf
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR009030 Growth_fac_rcpt_cys_sf
IPR001791 Laminin_G

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00008 EGF, 17 hits
PF07645 EGF_CA, 2 hits
PF12661 hEGF, 3 hits
PF00054 Laminin_G_1, 2 hits
PF02210 Laminin_G_2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00181 EGF, 28 hits
SM00179 EGF_CA, 23 hits
SM00282 LamG, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899 SSF49899, 4 hits
SSF57184 SSF57184, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00010 ASX_HYDROXYL, 16 hits
PS00022 EGF_1, 25 hits
PS01186 EGF_2, 17 hits
PS50026 EGF_3, 27 hits
PS01187 EGF_CA, 13 hits
PS50025 LAM_G_DOMAIN, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform A (identifier: P10040-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAKIANASLS QQQKQRQAET ATTTTTTVAA SVETATTTAR SRDRTKSAAQ
60 70 80 90 100
ITSHLLKRAI SVYSSPQWIP LFILIYLATD VASVAVPTKE AYFNGSTYLR
110 120 130 140 150
LTTPMPIWDH SAISFRSCRG GEILAQQYNK NSIVISVLND FLQISLAGPA
160 170 180 190 200
VHGPNNRLDV KLPYQLLDNR WHTLQFKYEY GNLYLHVDRA ASIFANSTYN
210 220 230 240 250
SQFLTNQDIG YKDAILILGN SFSGCLLDGP GLQFVNNSTV QNVVFGHCPL
260 270 280 290 300
TPGPCSDHDL FTRLPDNFCL NDPCMGHGTC SSSPEGYECR CTARYSGKNC
310 320 330 340 350
QKDNGSPCAK NPCENGGSCL ENSRGDYQCF CDPNHSGQHC ETEVNIHPLC
360 370 380 390 400
QTNPCLNNGA CVVIGGSGAL TCECPKGYAG ARCEVDTDEC ASQPCQNNGS
410 420 430 440 450
CIDRINGFSC DCSGTGYTGA FCQTNVDECD KNPCLNGGRC FDTYGWYTCQ
460 470 480 490 500
CLDGWGGEIC DRPMTCQTQQ CLNGGTCLDK PIGFQCLCPP EYTGELCQIA
510 520 530 540 550
PSCAQQCPID SECVGGKCVC KPGSSGYNCQ TSTGDGASAL ALTPINCNAT
560 570 580 590 600
NGKCLNGGTC SMNGTHCYCA VGYSGDRCEK AENCSPLNCQ EPMVCVQNQC
610 620 630 640 650
LCPENKVCNQ CATQPCQNGG ECVDLPNGDY ECKCTRGWTG RTCGNDVDEC
660 670 680 690 700
TLHPKICGNG ICKNEKGSYK CYCTPGFTGV HCDSDVDECL SFPCLNGATC
710 720 730 740 750
HNKINAYECV CQPGYEGENC EVDIDECGSN PCSNGSTCID RINNFTCNCI
760 770 780 790 800
PGMTGRICDI DIDDCVGDPC LNGGQCIDQL GGFRCDCSGT GYEGENCELN
810 820 830 840 850
IDECLSNPCT NGAKCLDRVK DYFCDCHNGY KGKNCEQDIN ECESNPCQYN
860 870 880 890 900
GNCLERSNIT LYQMSRITDL PKVFSQPFSF ENASGYECVC VPGIIGKNCE
910 920 930 940 950
ININECDSNP CSKHGNCNDG IGTYTCECEP GFEGTHCEIN IDECDRYNPC
960 970 980 990 1000
QRGTCYDQID DYDCDCDANY GGKNCSVLLK GCDQNPCLNG GACLPYLINE
1010 1020 1030 1040 1050
VTHLYNCTCE NGFQGDKCEK TTTLSMVATS LISVTTEREE GYDINLQFRT
1060 1070 1080 1090 1100
TLPNGVLAFG TTGEKNEPVS YILELINGRL NLHSSLLNKW EGVFIGSKLN
1110 1120 1130 1140 1150
DSNWHKVFVA INTSHLVLSA NDEQAIFPVG SYETANNSQP SFPRTYLGGT
1160 1170 1180 1190 1200
IPNLKSYLRH LTHQPSAFVG CMQDIMVNGK WIFPDEQDAN ISYTKLENVQ
1210 1220 1230 1240 1250
SGCPRTEQCK PNPCHSNGEC TDLWHTFACH CPRPFFGHTC QHNMTAATFG
1260 1270 1280 1290 1300
HENTTHSAVI VETTDVARRA IRSILDISMF IRTREPTGQV FYLGTDPRKA
1310 1320 1330 1340 1350
PTKNIGDSYV AAKLHGGELL VKMQFSGTPE AYTVGGQKLD NGYNHLIEVV
1360 1370 1380 1390 1400
RNQTLVQVKL NGTEYFRKTL STTGLLDAQV LYLGGPAPTR ESLLGATTEP
1410 1420 1430 1440 1450
GIIPVPGAGI PIEDTTVPKE ADDSRDYFKG IIQDVKVSNG SLNLIVEMYS
1460 1470 1480 1490 1500
LNVTDVQVNA KPLGAVTIDR ASVLPGEVSD DLCRKNPCLH NAECRNTWND
1510 1520 1530 1540 1550
YTCKCPNGYK GKNCQEIEFC QHVTCPGQSL CQNLDDGYEC VTNTTFTGQE
1560 1570 1580 1590 1600
RSPLAFFYFQ EQQSDDIVSE ASPKQTLKPV IDIAFRTRAG GTLLYIDNVD
1610 1620 1630 1640 1650
GFFEIGVNGG RVTITWKLSA LHFGESARFE KENTDGEWSR IYLRAHNSKL
1660 1670 1680 1690 1700
EGGWKGWESM VDPTPAFSTD IDQAAFQSLI ATSTQVYLGG MPESRQARGS
1710 1720 1730 1740 1750
TLSAQQGSQF KGCVGEARVG DLLLPYFSMA ELYSRTNVSV QQKAQFRLNA
1760 1770 1780 1790 1800
TRPEEGCILC FQSDCKNDGF CQSPSDEYAC TCQPGFEGDD CGTDIDECLN
1810 1820 1830 1840 1850
TECLNNGTCI NQVAAFFCQC QPGFEGQHCE QNIDECADQP CHNGGNCTDL
1860 1870 1880 1890 1900
IASYVCDCPE DYMGPQCDVL KQMTCENEPC RNGSTCQNGF NASTGNNFTC
1910 1920 1930 1940 1950
TCVPGFEGPL CDIPFCEITP CDNGGLCLTT GAVPMCKCSL GYTGRLCEQD
1960 1970 1980 1990 2000
INECESNPCQ NGGQCKDLVG RYECDCQGTG FEGIRCENDI DECNMEGDYC
2010 2020 2030 2040 2050
GGLGRCFNKP GSFQCICQKP YCGAYCNFTD PCNATDLCSN GGRCVESCGA
2060 2070 2080 2090 2100
KPDYYCECPE GFAGKNCTAP ITAKEDGPST TDIAIIVIPV VVVLLLIAGA
2110 2120 2130 2140
LLGTFLVMAR NKRATRGTYS PSAQEYCNPR LEMDNVLKPP PEERLI
Length:2,146
Mass (Da):233,572
Last modified:June 21, 2005 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8E23B9E32B761115
GO
Isoform B (identifier: P10040-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     526-526: G → ASDMEPLTPLELDILDATLCPSEKKKRYISPEWLKRKRCELKLS

Show »
Length:2,189
Mass (Da):238,643
Checksum:i89C31579A5DDDA38
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4K7R8A0A0B4K7R8_DROME
Crumbs, isoform C
crb 04, 0509, 1384, 20, CRB
2,253Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KHS1A0A0B4KHS1_DROME
Crumbs, isoform D
crb 04, 0509, 1384, 20, CRB
2,203Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAM49878 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1661 – 1673VDPTP…TDIDQ → WWIRRQLFPRTSTK in CAA28793 (PubMed:3107986).CuratedAdd BLAST13
Sequence conflicti1719V → L in AAA28428 (PubMed:2344615).Curated1
Sequence conflicti1952N → K in CAA28793 (PubMed:3107986).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_031870526G → ASDMEPLTPLELDILDATLC PSEKKKRYISPEWLKRKRCE LKLS in isoform B. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M33753 mRNA Translation: AAA28428.1
AE014297 Genomic DNA Translation: AAF56276.1
AE014297 Genomic DNA Translation: ABI31202.1
AY118509 mRNA Translation: AAM49878.1 Different initiation.
X05144 mRNA Translation: CAA28793.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A35672
B26637

NCBI Reference Sequences

More...
RefSeqi
NP_001036751.1, NM_001043286.2 [P10040-2]
NP_524480.2, NM_079756.3 [P10040-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0084603; FBpp0083987; FBgn0259685 [P10040-1]
FBtr0111008; FBpp0110307; FBgn0259685 [P10040-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
42896

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG6383

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M33753 mRNA Translation: AAA28428.1
AE014297 Genomic DNA Translation: AAF56276.1
AE014297 Genomic DNA Translation: ABI31202.1
AY118509 mRNA Translation: AAM49878.1 Different initiation.
X05144 mRNA Translation: CAA28793.1
PIRiA35672
B26637
RefSeqiNP_001036751.1, NM_001043286.2 [P10040-2]
NP_524480.2, NM_079756.3 [P10040-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4WSIX-ray2.95X/Y2110-2146[»]
4YL8X-ray1.50B2110-2146[»]
SMRiP10040
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi67824, 56 interactors
DIPiDIP-40915N
IntActiP10040, 9 interactors
MINTiP10040

Protein family/group databases

TCDBi9.B.87.1.11 the selenoprotein p receptor (selp-receptor) family

PTM databases

iPTMnetiP10040

Proteomic databases

PaxDbiP10040
PRIDEiP10040

Genome annotation databases

EnsemblMetazoaiFBtr0084603; FBpp0083987; FBgn0259685 [P10040-1]
FBtr0111008; FBpp0110307; FBgn0259685 [P10040-2]
GeneIDi42896
KEGGidme:Dmel_CG6383

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
42896
FlyBaseiFBgn0259685 crb

Phylogenomic databases

eggNOGiKOG1217 Eukaryota
ENOG410XP6K LUCA
HOGENOMiCLU_000827_0_0_1
InParanoidiP10040
KOiK16681
OMAiYDIQFRF
PhylomeDBiP10040

Enzyme and pathway databases

ReactomeiR-DME-1912420 Pre-NOTCH Processing in Golgi
R-DME-9013700 NOTCH4 Activation and Transmission of Signal to the Nucleus
R-DME-9604323 Negative regulation of NOTCH4 signaling
SignaLinkiP10040

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
42896

Protein Ontology

More...
PROi
PR:P10040

Gene expression databases

BgeeiFBgn0259685 Expressed in embryo and 32 other tissues
ExpressionAtlasiP10040 baseline and differential
GenevisibleiP10040 DM

Family and domain databases

InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR009030 Growth_fac_rcpt_cys_sf
IPR001791 Laminin_G
PfamiView protein in Pfam
PF00008 EGF, 17 hits
PF07645 EGF_CA, 2 hits
PF12661 hEGF, 3 hits
PF00054 Laminin_G_1, 2 hits
PF02210 Laminin_G_2, 1 hit
SMARTiView protein in SMART
SM00181 EGF, 28 hits
SM00179 EGF_CA, 23 hits
SM00282 LamG, 3 hits
SUPFAMiSSF49899 SSF49899, 4 hits
SSF57184 SSF57184, 1 hit
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 16 hits
PS00022 EGF_1, 25 hits
PS01186 EGF_2, 17 hits
PS50026 EGF_3, 27 hits
PS01187 EGF_CA, 13 hits
PS50025 LAM_G_DOMAIN, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCRB_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P10040
Secondary accession number(s): Q0KI19, Q8MSX5, Q9VC97
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: June 21, 2005
Last modified: February 26, 2020
This is version 215 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again