Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 26 (29 Sep 2021)
Sequence version 1 (28 Feb 2018)
Previous versions | rss
Add a publicationFeedback
Protein

EEF1AKMT4-ECE2 readthrough transcript protein

Gene

Eef1akmt4-Ece2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Converts big endothelin-1 to endothelin-1. May also have methyltransferase activity (By similarity).

May play a role in amyloid-beta processing (PubMed:12464614).

By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by phosphoramidon.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei26S-adenosyl-L-methionineBy similarity1
Binding sitei30S-adenosyl-L-methionineBy similarity1
Binding sitei41S-adenosyl-L-methionine; via amide nitrogenBy similarity1
Binding sitei66S-adenosyl-L-methionine; via carbonyl oxygenBy similarity1
Binding sitei130S-adenosyl-L-methionineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi718Zinc; catalyticPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei719PROSITE-ProRule annotation1
Metal bindingi722Zinc; catalyticPROSITE-ProRule annotation1
Metal bindingi778Zinc; catalyticPROSITE-ProRule annotation1
Active sitei782Proton donorPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Methyltransferase, Multifunctional enzyme, Protease, Transferase
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-375276, Peptide ligand-binding receptors

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
EEF1AKMT4-ECE2 readthrough transcript proteinBy similarity (EC:3.4.24.71By similarity)
Including the following 2 domains:
Methyltransferase-like regionCurated (EC:2.1.1.-)
Endothelin-converting enzyme 2 regionCurated (EC:3.4.24.71)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Eef1akmt4-Ece2By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1101356, Eef1akmt4-Ece2

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000115293

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 178CytoplasmicCuratedAdd BLAST178
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei179 – 199Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini200 – 881LumenalCuratedAdd BLAST682

Keywords - Cellular componenti

Cytoplasmic vesicle, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Eef1akmt4-Ece2 and Ece2 double mutant mice are fertile and healthy, and do not display any abnormality in terms of growth or aging.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003107601 – 881EEF1AKMT4-ECE2 readthrough transcript proteinAdd BLAST881

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei39PhosphotyrosineBy similarity1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi210 ↔ 215PROSITE-ProRule annotation
Disulfide bondi233 ↔ 866PROSITE-ProRule annotation
Disulfide bondi241 ↔ 826PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi277N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi281N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi297 ↔ 546PROSITE-ProRule annotation
Glycosylationi322N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi382N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi427N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi494N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi650N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi743N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi751N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi755 ↔ 878PROSITE-ProRule annotation
Isoform Eef1akmt4-Ece2-2 (identifier: P0DPD9-2)
Modified residuei174PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PRoteomics IDEntifications database

More...
PRIDEi
P0DPD9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
277448
277449 [P0DPD9-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
P0DPD9, 9 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P0DPD9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P0DPD9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at high levels in central nervous system. Expressed in adrenal glands, ovary and uterus, and at low levels in heart.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Weakly expressed in mesenchyme and parts of neural tube at 10.5 dpc. At 13.5 dpc, expressed in anterior part of neural tube, dorsal root ganglia, bilateral sympathetic trunk and heart.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000022842, Expressed in hypothalamus and 275 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
E9QKA6, MM

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P0DPD9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini209 – 881Peptidase M13PROSITE-ProRule annotationAdd BLAST673

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 160Methyltransferase-like regionCuratedAdd BLAST160
Regioni88 – 89S-adenosyl-L-methionine bindingBy similarity2
Regioni113 – 114S-adenosyl-L-methionine bindingBy similarity2

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

In the N-terminal section; belongs to the methyltransferase superfamily.Curated
In the C-terminal section; belongs to the peptidase M13 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156921

Identification of Orthologs from Complete Genome Data

More...
OMAi
FGWAQVW

Family and domain databases

Conserved Domains Database

More...
CDDi
cd08662, M13, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.1380.10, 1 hit
3.40.390.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024079, MetalloPept_cat_dom_sf
IPR041698, Methyltransf_25
IPR000718, Peptidase_M13
IPR018497, Peptidase_M13_C
IPR042089, Peptidase_M13_dom_2
IPR008753, Peptidase_M13_N
IPR029063, SAM-dependent_MTases

The PANTHER Classification System

More...
PANTHERi
PTHR11733, PTHR11733, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13649, Methyltransf_25, 1 hit
PF01431, Peptidase_M13, 1 hit
PF05649, Peptidase_M13_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00786, NEPRILYSIN

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53335, SSF53335, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51885, NEPRILYSIN, 1 hit
PS00142, ZINC_PROTEASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform Eef1akmt4-Ece2-1 (identifier: P0DPD9-1) [UniParc]FASTAAdd to basket
Also known as: ECE-2a-11 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASPRTPVSP PELPEKNFQY RQVQYWDQRY KDAADSGPYE WFGDFASFRA
60 70 80 90 100
LLEPELCPED RILVLGCGNS ALSYELFLGG FPNVTSVDYS PVVVAAMQVR
110 120 130 140 150
YAHVPSLRWE TMDVRALDFP SGSFDVVLEK GTLDAMLAGE PDPWNVSSEG
160 170 180 190 200
VHTVDQVLSE VGFQKRTRQL FGSHTQLELV LAGLILVLAA LLLGCLVALW
210 220 230 240 250
VHRDPAHSTC VTEACIRVAG KILESLDRGV SPCQDFYQFS CGGWIRRNPL
260 270 280 290 300
PNGRSRWNTF NSLWDQNQAI LKHLLENTTF NSSSEAERKT RSFYLSCLQS
310 320 330 340 350
ERIEKLGAKP LRDLIDKIGG WNITGPWDED SFMDVLKAVA GTYRATPFFT
360 370 380 390 400
VYVSADSKSS NSNIIQVDQS GLFLPSRDYY LNRTANEKVL TAYLDYMVEL
410 420 430 440 450
GVLLGGQPTS TREQMQQVLE LEIQLANITV PQDQRRDEEK IYHKMSISEL
460 470 480 490 500
QALAPAVDWL EFLSFLLSPL ELGDSEPVVV YGTEYLQQVS ELINRTEPSI
510 520 530 540 550
LNNYLIWNLV QKTTSSLDQR FETAQEKLLE TLYGTKKSCT PRWQTCISNT
560 570 580 590 600
DDALGFALGS LFVKATFDRQ SKEIAEGMIN EIRSAFEETL GDLVWMDEKT
610 620 630 640 650
RLAAKEKADA IYDMIGFPDF ILEPKELDDV YDGYEVSEDS FFQNMLNLYN
660 670 680 690 700
FSAKVMADQL RKPPSRDQWS MTPQTVNAYY LPTKNEIVFP AGILQAPFYA
710 720 730 740 750
HNHPKALNFG GIGVVMGHEL THAFDDQGRE YDKEGNLRPW WQNESLTAFQ
760 770 780 790 800
NHTACMEEQY SQYQVNGERL NGLQTLGENI ADNGGLKAAY NAYKAWLRKH
810 820 830 840 850
GEEQPLPAVG LTNHQLFFVG FAQVWCSVRT PESSHEGLVT DPHSPARFRV
860 870 880
LGTLSNSRDF LRHFGCPVGS PMNPGQLCEV W
Note: Based on a naturally occurring readthrough transcript which produces an Eef1akmt4-Ece2 fusion protein.Curated
Length:881
Mass (Da):99,480
Last modified:February 28, 2018 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i43F512214E293D89
GO
Isoform Eef1akmt4-Ece2-2 (identifier: P0DPD9-2) [UniParc] [UniParc]FASTAAdd to basket
Also known as: ECE-2a-21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     159-159: S → SEMVEYKRAKLRDEESPEITVEGRATRDSL

Note: Based on a naturally occurring readthrough transcript which produces an Eef1akmt4-Ece2 fusion protein.Curated
Show »
Length:910
Mass (Da):102,871
Checksum:iCF8720F6524CE17C
GO
Isoform Eef1akmt4-1 (identifier: P0DPE0-1) [UniParc] [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry P0DPE0.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:255
Mass (Da):28,531
GO
Isoform Ece2-1 (identifier: B2RQR8-1) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry B2RQR8.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:763
Mass (Da):86,231
GO
Isoform Ece2-2 (identifier: B2RQR8-2) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry B2RQR8.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:734
Mass (Da):82,841
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q1S5E9Q1S5_MOUSE
Endothelin-converting enzyme 2
Ece2
709Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6WM66F6WM66_MOUSE
Endothelin-converting enzyme 2
Ece2
527Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAO72356 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAO72357 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti359 – 365SSNSNII → RSYSNIT in AAO72356 (PubMed:12054617).Curated7
Sequence conflicti359 – 365SSNSNII → RSYSNIT in AAO72357 (PubMed:12054617).Curated7
Sequence conflicti483 – 484TE → MS in AAO72356 (PubMed:12054617).Curated2
Sequence conflicti483 – 484TE → MS in AAO72357 (PubMed:12054617).Curated2
Sequence conflicti632D → Y in AAO72356 (PubMed:12054617).Curated1
Sequence conflicti632D → Y in AAO72357 (PubMed:12054617).Curated1
Sequence conflicti696A → P in AAO72356 (PubMed:12054617).Curated1
Sequence conflicti696A → P in AAO72357 (PubMed:12054617).Curated1
Sequence conflicti717G → D in AAO72356 (PubMed:12054617).Curated1
Sequence conflicti717G → D in AAO72357 (PubMed:12054617).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_029335159S → SEMVEYKRAKLRDEESPEIT VEGRATRDSL in isoform Eef1akmt4-Ece2-2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC087898 Genomic DNA No translation available.
AF489569 mRNA Translation: AAO72356.1 Different initiation.
AF489570 mRNA Translation: AAO72357.1 Different initiation.

NCBI Reference Sequences

More...
RefSeqi
NP_808809.1, NM_177940.1 [P0DPD9-1]
NP_808810.1, NM_177941.1 [P0DPD9-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000079600; ENSMUSP00000078550; ENSMUSG00000115293 [P0DPD9-1]
ENSMUST00000120394; ENSMUSP00000113475; ENSMUSG00000115293 [P0DPD9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
110599584

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:110599584

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC087898 Genomic DNA No translation available.
AF489569 mRNA Translation: AAO72356.1 Different initiation.
AF489570 mRNA Translation: AAO72357.1 Different initiation.
RefSeqiNP_808809.1, NM_177940.1 [P0DPD9-1]
NP_808810.1, NM_177941.1 [P0DPD9-2]

3D structure databases

SMRiP0DPD9
ModBaseiSearch...

PTM databases

GlyGeniP0DPD9, 9 sites
iPTMnetiP0DPD9
PhosphoSitePlusiP0DPD9

Proteomic databases

PRIDEiP0DPD9
ProteomicsDBi277448
277449 [P0DPD9-2]

Genome annotation databases

EnsembliENSMUST00000079600; ENSMUSP00000078550; ENSMUSG00000115293 [P0DPD9-1]
ENSMUST00000120394; ENSMUSP00000113475; ENSMUSG00000115293 [P0DPD9-2]
GeneIDi110599584
KEGGimmu:110599584

Organism-specific databases

MGIiMGI:1101356, Eef1akmt4-Ece2
VEuPathDBiHostDB:ENSMUSG00000115293

Phylogenomic databases

GeneTreeiENSGT00940000156921
OMAiFGWAQVW

Enzyme and pathway databases

ReactomeiR-MMU-375276, Peptide ligand-binding receptors

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
107522, 3 hits in 59 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ece2, mouse

Protein Ontology

More...
PROi
PR:P0DPD9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000022842, Expressed in hypothalamus and 275 other tissues
GenevisibleiE9QKA6, MM

Family and domain databases

CDDicd08662, M13, 1 hit
Gene3Di1.10.1380.10, 1 hit
3.40.390.10, 1 hit
InterProiView protein in InterPro
IPR024079, MetalloPept_cat_dom_sf
IPR041698, Methyltransf_25
IPR000718, Peptidase_M13
IPR018497, Peptidase_M13_C
IPR042089, Peptidase_M13_dom_2
IPR008753, Peptidase_M13_N
IPR029063, SAM-dependent_MTases
PANTHERiPTHR11733, PTHR11733, 1 hit
PfamiView protein in Pfam
PF13649, Methyltransf_25, 1 hit
PF01431, Peptidase_M13, 1 hit
PF05649, Peptidase_M13_N, 1 hit
PRINTSiPR00786, NEPRILYSIN
SUPFAMiSSF53335, SSF53335, 1 hit
PROSITEiView protein in PROSITE
PS51885, NEPRILYSIN, 1 hit
PS00142, ZINC_PROTEASE, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEFCE2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P0DPD9
Secondary accession number(s): E9QKA6
, Q14BY3, Q80Z59, Q80Z60, Q9D8Q9, Q9D928
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 28, 2018
Last sequence update: February 28, 2018
Last modified: September 29, 2021
This is version 26 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again