Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sulfotransferase 1A3

Gene

SULT1A3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.

Caution

Found in a segmental duplication on p arm of chromosome 16 giving rise to two identical copies of this gene sharing exons with SLX1A and SLX1B. The ORFs of SULT1A3 and SULT1A4 differ with only a single nucleotide change that does not alter the encoded amino acid. It is not possible to determine whether any individual polymorphism is present within SULT1A3 or SULT1A4 (PubMed:15358107).1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei86Substrate1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei108Proton acceptorBy similarity1
Binding sitei130PAPS1
Binding sitei138PAPS1
Binding sitei146Substrate1
Binding sitei193PAPS1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi48 – 53PAPS6
Nucleotide bindingi227 – 232PAPS6
Nucleotide bindingi257 – 259PAPS3

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • amine sulfotransferase activity Source: CAFA
  • aryl sulfotransferase activity Source: CACAO
  • sulfate binding Source: CAFA
  • sulfotransferase activity Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processCatecholamine metabolism, Lipid metabolism, Steroid metabolism

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS05608-MONOMER

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-156584 Cytosolic sulfonation of small molecules
R-HSA-381038 XBP1(S) activates chaperone genes

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sulfotransferase 1A3 (EC:2.8.2.1)
Short name:
ST1A3
Alternative name(s):
Aryl sulfotransferase 1A3/1A4
Catecholamine-sulfating phenol sulfotransferase
HAST3
M-PST
Monoamine-sulfating phenol sulfotransferase
Placental estrogen sulfotransferase
Sulfotransferase 1A3/1A4
Sulfotransferase, monoamine-preferring
Thermolabile phenol sulfotransferase
Short name:
TL-PST
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SULT1A3
Synonyms:STM
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000261052.5

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11455 SULT1A3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600641 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P0DMM9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
105369243
445329
6818

Open Targets

More...
OpenTargetsi
ENSG00000261052

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1743293

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SULT1A3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000851591 – 295Sulfotransferase 1A3Add BLAST295

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The N-terminus is blocked.

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P0DMM9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P0DMM9

PeptideAtlas

More...
PeptideAtlasi
P0DMM9

PRoteomics IDEntifications database

More...
PRIDEi
P0DMM9

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P0DMM9-2 [P0DMM9-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P0DMM9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P0DMM9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Liver, colon, kidney, lung, brain, spleen, small intestine, placenta and leukocyte.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000261052 Expressed in 93 organ(s), highest expression level in mucosa of transverse colon

CleanEx database of gene expression profiles

More...
CleanExi
HS_SULT1A3
HS_SULT1A4

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P0DMM9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P0DMM9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA049500
HPA051051

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112687, 13 interactors
138644, 4 interactors

Protein interaction database and analysis system

More...
IntActi
P0DMM9, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000343645

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1295
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CJMX-ray2.40A1-295[»]
2A3RX-ray2.60A/B1-295[»]

Database of protein disorder

More...
DisProti
DP00011

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P0DMM9

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P0DMM9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni106 – 108Substrate binding3

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the sulfotransferase 1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1584 Eukaryota
ENOG4111H56 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000164316

KEGG Orthology (KO)

More...
KOi
K01014

Identification of Orthologs from Complete Genome Data

More...
OMAi
VHFDNMK

Database of Orthologous Groups

More...
OrthoDBi
780670at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P0DMM9

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027417 P-loop_NTPase
IPR000863 Sulfotransferase_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00685 Sulfotransfer_1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P0DMM9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELIQDTSRP PLEYVKGVPL IKYFAEALGP LQSFQARPDD LLINTYPKSG
60 70 80 90 100
TTWVSQILDM IYQGGDLEKC NRAPIYVRVP FLEVNDPGEP SGLETLKDTP
110 120 130 140 150
PPRLIKSHLP LALLPQTLLD QKVKVVYVAR NPKDVAVSYY HFHRMEKAHP
160 170 180 190 200
EPGTWDSFLE KFMAGEVSYG SWYQHVQEWW ELSRTHPVLY LFYEDMKENP
210 220 230 240 250
KREIQKILEF VGRSLPEETM DFMVQHTSFK EMKKNPMTNY TTVPQELMDH
260 270 280 290
SISPFMRKGM AGDWKTTFTV AQNERFDADY AEKMAGCSLS FRSEL
Length:295
Mass (Da):34,196
Last modified:September 3, 2014 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iECDDEC03DBE30D46
GO
Isoform 2 (identifier: P0DMM9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     167-295: VSYGSWYQHV...GCSLSFRSEL → GGLDWRKEGVKPRGGGYNVQQPCVGAPCPLL

Note: No experimental confirmation available.Curated
Show »
Length:197
Mass (Da):22,069
Checksum:i44C5F13EDA71BC1D
GO
Isoform 3 (identifier: P0DMM9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     198-198: E → EEPSAAQ

Show »
Length:301
Mass (Da):34,780
Checksum:i7018229AD3F67542
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BRT0H3BRT0_HUMAN
Sulfotransferase
SULT1A4 SULT1A3
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BPL6H3BPL6_HUMAN
Sulfotransferase
SULT1A3
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A6YYL2A0A0A6YYL2_HUMAN
Sulfotransferase
SULT1A4
301Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BNY7H3BNY7_HUMAN
Sulfotransferase
SULT1A4
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Isoform 2 : The sequence BAC85507 differs from that shown. Reason: Frameshift at position 101.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti220 – 225MDFMVQ → VDLMVE in AAC99987 (Ref. 8) Curated6
Sequence conflicti235N → T in AAC99987 (Ref. 8) Curated1
Sequence conflicti244 – 245PQ → RR in AAC99987 (Ref. 8) Curated2
Sequence conflicti290S → T in AAC99987 (Ref. 8) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_071108101P → H Decreases levels of sulfotransferase activity. 1 PublicationCorresponds to variant dbSNP:rs751527244Ensembl.1
Natural variantiVAR_071109101P → L Decreases levels of sulfotransferase activity. 1 PublicationCorresponds to variant dbSNP:rs751527244Ensembl.1
Natural variantiVAR_071110144R → C No effect on sulfotransferase activity. 1 PublicationCorresponds to variant dbSNP:rs1293732453Ensembl.1
Natural variantiVAR_071111234K → N Decreases levels of sulfotransferase activity; accelerates proteasome-dependent degradation. 1 PublicationCorresponds to variant dbSNP:rs1328799050Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_012326167 – 295VSYGS…FRSEL → GGLDWRKEGVKPRGGGYNVQ QPCVGAPCPLL in isoform 2. 1 PublicationAdd BLAST129
Alternative sequenceiVSP_047771198E → EEPSAAQ in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L19956 mRNA Translation: AAA02943.1
L25275 mRNA Translation: AAA36523.1
L19956 mRNA Translation: AAA17723.1
U20499 Genomic DNA Translation: AAA64490.1
X84653 mRNA Translation: CAA59146.1
L34160 Genomic DNA No translation available.
U37686 Genomic DNA Translation: AAA86536.1
U34199 mRNA Translation: AAC99987.1
AK122733 mRNA Translation: BAC85507.1 Frameshift.
AK298073 mRNA Translation: BAG60362.1
AC106782 Genomic DNA No translation available.
AC133555 Genomic DNA No translation available.
AB111094 mRNA Translation: BAE94928.1
BC014471 mRNA Translation: AAH14471.1
BC078144 mRNA Translation: AAH78144.1
U08099 Genomic DNA Translation: AAA82126.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10674.1 [P0DMM9-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
A55451

NCBI Reference Sequences

More...
RefSeqi
NP_001017390.1, NM_001017390.2 [P0DMM9-1]
NP_808220.1, NM_177552.3 [P0DMM9-1]
XP_011506903.1, XM_011508601.1
XP_016855108.1, XM_016999619.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.460558
Hs.744871

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000338971; ENSP00000343645; ENSG00000261052 [P0DMM9-1]
ENST00000395138; ENSP00000378570; ENSG00000261052 [P0DMM9-1]
ENST00000563322; ENSP00000454518; ENSG00000261052 [P0DMM9-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
445329
6818

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:445329
hsa:6818

UCSC genome browser

More...
UCSCi
uc010bzt.4 human [P0DMM9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L19956 mRNA Translation: AAA02943.1
L25275 mRNA Translation: AAA36523.1
L19956 mRNA Translation: AAA17723.1
U20499 Genomic DNA Translation: AAA64490.1
X84653 mRNA Translation: CAA59146.1
L34160 Genomic DNA No translation available.
U37686 Genomic DNA Translation: AAA86536.1
U34199 mRNA Translation: AAC99987.1
AK122733 mRNA Translation: BAC85507.1 Frameshift.
AK298073 mRNA Translation: BAG60362.1
AC106782 Genomic DNA No translation available.
AC133555 Genomic DNA No translation available.
AB111094 mRNA Translation: BAE94928.1
BC014471 mRNA Translation: AAH14471.1
BC078144 mRNA Translation: AAH78144.1
U08099 Genomic DNA Translation: AAA82126.1
CCDSiCCDS10674.1 [P0DMM9-1]
PIRiA55451
RefSeqiNP_001017390.1, NM_001017390.2 [P0DMM9-1]
NP_808220.1, NM_177552.3 [P0DMM9-1]
XP_011506903.1, XM_011508601.1
XP_016855108.1, XM_016999619.1
UniGeneiHs.460558
Hs.744871

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CJMX-ray2.40A1-295[»]
2A3RX-ray2.60A/B1-295[»]
DisProtiDP00011
ProteinModelPortaliP0DMM9
SMRiP0DMM9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112687, 13 interactors
138644, 4 interactors
IntActiP0DMM9, 3 interactors
STRINGi9606.ENSP00000343645

Chemistry databases

ChEMBLiCHEMBL1743293

PTM databases

iPTMnetiP0DMM9
PhosphoSitePlusiP0DMM9

Polymorphism and mutation databases

BioMutaiSULT1A3

Proteomic databases

jPOSTiP0DMM9
PaxDbiP0DMM9
PeptideAtlasiP0DMM9
PRIDEiP0DMM9
TopDownProteomicsiP0DMM9-2 [P0DMM9-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338971; ENSP00000343645; ENSG00000261052 [P0DMM9-1]
ENST00000395138; ENSP00000378570; ENSG00000261052 [P0DMM9-1]
ENST00000563322; ENSP00000454518; ENSG00000261052 [P0DMM9-3]
GeneIDi445329
6818
KEGGihsa:445329
hsa:6818
UCSCiuc010bzt.4 human [P0DMM9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
445329
6818
DisGeNETi105369243
445329
6818
EuPathDBiHostDB:ENSG00000261052.5

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SULT1A3
HGNCiHGNC:11455 SULT1A3
HPAiHPA049500
HPA051051
MIMi600641 gene
neXtProtiNX_P0DMM9
OpenTargetsiENSG00000261052

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1584 Eukaryota
ENOG4111H56 LUCA
GeneTreeiENSGT00940000164316
KOiK01014
OMAiVHFDNMK
OrthoDBi780670at2759
PhylomeDBiP0DMM9

Enzyme and pathway databases

BioCyciMetaCyc:HS05608-MONOMER
ReactomeiR-HSA-156584 Cytosolic sulfonation of small molecules
R-HSA-381038 XBP1(S) activates chaperone genes

Miscellaneous databases

Protein Ontology

More...
PROi
PR:P0DMM9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000261052 Expressed in 93 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_SULT1A3
HS_SULT1A4
ExpressionAtlasiP0DMM9 baseline and differential
GenevisibleiP0DMM9 HS

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR000863 Sulfotransferase_dom
PfamiView protein in Pfam
PF00685 Sulfotransfer_1, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiST1A3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P0DMM9
Secondary accession number(s): B4DNV0
, O95603, P50224, Q1ET66, Q6ZWJ5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 3, 2014
Last sequence update: September 3, 2014
Last modified: January 16, 2019
This is version 42 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again