Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sulfotransferase 1A3

Gene

SULT1A3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.

Caution

Found in a segmental duplication on p arm of chromosome 16 giving rise to two identical copies of this gene sharing exons with SLX1A and SLX1B. The ORFs of SULT1A3 and SULT1A4 differ with only a single nucleotide change that does not alter the encoded amino acid. It is not possible to determine whether any individual polymorphism is present within SULT1A3 or SULT1A4 (PubMed:15358107).1 Publication

Catalytic activityi

3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei86Substrate1
Active sitei108Proton acceptorBy similarity1
Binding sitei130PAPS1
Binding sitei138PAPS1
Binding sitei146Substrate1
Binding sitei193PAPS1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi48 – 53PAPS6
Nucleotide bindingi227 – 232PAPS6
Nucleotide bindingi257 – 259PAPS3

GO - Molecular functioni

  • amine sulfotransferase activity Source: CAFA
  • aryl sulfotransferase activity Source: CACAO
  • sulfate binding Source: CAFA
  • sulfotransferase activity Source: BHF-UCL

GO - Biological processi

Keywordsi

Molecular functionTransferase
Biological processCatecholamine metabolism, Lipid metabolism, Steroid metabolism

Enzyme and pathway databases

BioCyciMetaCyc:HS05608-MONOMER
ReactomeiR-HSA-156584 Cytosolic sulfonation of small molecules
R-HSA-381038 XBP1(S) activates chaperone genes

Names & Taxonomyi

Protein namesi
Recommended name:
Sulfotransferase 1A3 (EC:2.8.2.1)
Short name:
ST1A3
Alternative name(s):
Aryl sulfotransferase 1A3/1A4
Catecholamine-sulfating phenol sulfotransferase
HAST3
M-PST
Monoamine-sulfating phenol sulfotransferase
Placental estrogen sulfotransferase
Sulfotransferase 1A3/1A4
Sulfotransferase, monoamine-preferring
Thermolabile phenol sulfotransferase
Short name:
TL-PST
Gene namesi
Name:SULT1A3
Synonyms:STM
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000261052.5
HGNCiHGNC:11455 SULT1A3
MIMi600641 gene
neXtProtiNX_P0DMM9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi105369243
445329
6818
OpenTargetsiENSG00000261052

Chemistry databases

ChEMBLiCHEMBL1743293

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000851591 – 295Sulfotransferase 1A3Add BLAST295

Post-translational modificationi

The N-terminus is blocked.

Proteomic databases

PaxDbiP0DMM9
PeptideAtlasiP0DMM9
PRIDEiP0DMM9
TopDownProteomicsiP0DMM9-2 [P0DMM9-2]

PTM databases

iPTMnetiP0DMM9
PhosphoSitePlusiP0DMM9

Expressioni

Tissue specificityi

Liver, colon, kidney, lung, brain, spleen, small intestine, placenta and leukocyte.

Gene expression databases

BgeeiENSG00000261052 Expressed in 93 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_SULT1A3
HS_SULT1A4
ExpressionAtlasiP0DMM9 baseline and differential
GenevisibleiP0DMM9 HS

Organism-specific databases

HPAiHPA049500
HPA051051

Interactioni

Subunit structurei

Homodimer.1 Publication

Binary interactionsi

Protein-protein interaction databases

BioGridi112687, 13 interactors
138644, 4 interactors
IntActiP0DMM9, 3 interactors
STRINGi9606.ENSP00000343645

Structurei

Secondary structure

1295
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

DisProtiDP00011
ProteinModelPortaliP0DMM9
SMRiP0DMM9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni106 – 108Substrate binding3

Sequence similaritiesi

Belongs to the sulfotransferase 1 family.Curated

Phylogenomic databases

eggNOGiKOG1584 Eukaryota
ENOG4111H56 LUCA
GeneTreeiENSGT00760000118932
KOiK01014
OMAiVHFDNMK
PhylomeDBiP0DMM9

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR000863 Sulfotransferase_dom
PfamiView protein in Pfam
PF00685 Sulfotransfer_1, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P0DMM9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELIQDTSRP PLEYVKGVPL IKYFAEALGP LQSFQARPDD LLINTYPKSG
60 70 80 90 100
TTWVSQILDM IYQGGDLEKC NRAPIYVRVP FLEVNDPGEP SGLETLKDTP
110 120 130 140 150
PPRLIKSHLP LALLPQTLLD QKVKVVYVAR NPKDVAVSYY HFHRMEKAHP
160 170 180 190 200
EPGTWDSFLE KFMAGEVSYG SWYQHVQEWW ELSRTHPVLY LFYEDMKENP
210 220 230 240 250
KREIQKILEF VGRSLPEETM DFMVQHTSFK EMKKNPMTNY TTVPQELMDH
260 270 280 290
SISPFMRKGM AGDWKTTFTV AQNERFDADY AEKMAGCSLS FRSEL
Length:295
Mass (Da):34,196
Last modified:September 3, 2014 - v1
Checksum:iECDDEC03DBE30D46
GO
Isoform 2 (identifier: P0DMM9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     167-295: VSYGSWYQHV...GCSLSFRSEL → GGLDWRKEGVKPRGGGYNVQQPCVGAPCPLL

Note: No experimental confirmation available.Curated
Show »
Length:197
Mass (Da):22,069
Checksum:i44C5F13EDA71BC1D
GO
Isoform 3 (identifier: P0DMM9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     198-198: E → EEPSAAQ

Show »
Length:301
Mass (Da):34,780
Checksum:i7018229AD3F67542
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BRT0H3BRT0_HUMAN
Sulfotransferase
SULT1A4 SULT1A3
50Annotation score:
H3BPL6H3BPL6_HUMAN
Sulfotransferase
SULT1A3
135Annotation score:
A0A0A6YYL2A0A0A6YYL2_HUMAN
Sulfotransferase
SULT1A4
301Annotation score:
H3BNY7H3BNY7_HUMAN
Sulfotransferase
SULT1A4
87Annotation score:

Sequence cautioni

Isoform 2 : The sequence BAC85507 differs from that shown. Reason: Frameshift at position 101.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti220 – 225MDFMVQ → VDLMVE in AAC99987 (Ref. 8) Curated6
Sequence conflicti235N → T in AAC99987 (Ref. 8) Curated1
Sequence conflicti244 – 245PQ → RR in AAC99987 (Ref. 8) Curated2
Sequence conflicti290S → T in AAC99987 (Ref. 8) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_071108101P → H Decreases levels of sulfotransferase activity. 1 Publication1
Natural variantiVAR_071109101P → L Decreases levels of sulfotransferase activity. 1 PublicationCorresponds to variant dbSNP:rs751527244Ensembl.1
Natural variantiVAR_071110144R → C No effect on sulfotransferase activity. 1 PublicationCorresponds to variant dbSNP:rs1293732453Ensembl.1
Natural variantiVAR_071111234K → N Decreases levels of sulfotransferase activity; accelerates proteasome-dependent degradation. 1 PublicationCorresponds to variant dbSNP:rs1328799050Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_012326167 – 295VSYGS…FRSEL → GGLDWRKEGVKPRGGGYNVQ QPCVGAPCPLL in isoform 2. 1 PublicationAdd BLAST129
Alternative sequenceiVSP_047771198E → EEPSAAQ in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L19956 mRNA Translation: AAA02943.1
L25275 mRNA Translation: AAA36523.1
L19956 mRNA Translation: AAA17723.1
U20499 Genomic DNA Translation: AAA64490.1
X84653 mRNA Translation: CAA59146.1
L34160 Genomic DNA No translation available.
U37686 Genomic DNA Translation: AAA86536.1
U34199 mRNA Translation: AAC99987.1
AK122733 mRNA Translation: BAC85507.1 Frameshift.
AK298073 mRNA Translation: BAG60362.1
AC106782 Genomic DNA No translation available.
AC133555 Genomic DNA No translation available.
AB111094 mRNA Translation: BAE94928.1
BC014471 mRNA Translation: AAH14471.1
BC078144 mRNA Translation: AAH78144.1
U08099 Genomic DNA Translation: AAA82126.1
CCDSiCCDS10674.1 [P0DMM9-1]
PIRiA55451
RefSeqiNP_001017390.1, NM_001017390.2 [P0DMM9-1]
NP_808220.1, NM_177552.3 [P0DMM9-1]
XP_011506903.1, XM_011508601.1
XP_016855108.1, XM_016999619.1
UniGeneiHs.460558
Hs.744871

Genome annotation databases

EnsembliENST00000338971; ENSP00000343645; ENSG00000261052 [P0DMM9-1]
ENST00000395138; ENSP00000378570; ENSG00000261052 [P0DMM9-1]
ENST00000563322; ENSP00000454518; ENSG00000261052 [P0DMM9-3]
GeneIDi445329
6818
KEGGihsa:445329
hsa:6818
UCSCiuc010bzt.4 human [P0DMM9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L19956 mRNA Translation: AAA02943.1
L25275 mRNA Translation: AAA36523.1
L19956 mRNA Translation: AAA17723.1
U20499 Genomic DNA Translation: AAA64490.1
X84653 mRNA Translation: CAA59146.1
L34160 Genomic DNA No translation available.
U37686 Genomic DNA Translation: AAA86536.1
U34199 mRNA Translation: AAC99987.1
AK122733 mRNA Translation: BAC85507.1 Frameshift.
AK298073 mRNA Translation: BAG60362.1
AC106782 Genomic DNA No translation available.
AC133555 Genomic DNA No translation available.
AB111094 mRNA Translation: BAE94928.1
BC014471 mRNA Translation: AAH14471.1
BC078144 mRNA Translation: AAH78144.1
U08099 Genomic DNA Translation: AAA82126.1
CCDSiCCDS10674.1 [P0DMM9-1]
PIRiA55451
RefSeqiNP_001017390.1, NM_001017390.2 [P0DMM9-1]
NP_808220.1, NM_177552.3 [P0DMM9-1]
XP_011506903.1, XM_011508601.1
XP_016855108.1, XM_016999619.1
UniGeneiHs.460558
Hs.744871

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CJMX-ray2.40A1-295[»]
2A3RX-ray2.60A/B1-295[»]
DisProtiDP00011
ProteinModelPortaliP0DMM9
SMRiP0DMM9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112687, 13 interactors
138644, 4 interactors
IntActiP0DMM9, 3 interactors
STRINGi9606.ENSP00000343645

Chemistry databases

ChEMBLiCHEMBL1743293

PTM databases

iPTMnetiP0DMM9
PhosphoSitePlusiP0DMM9

Proteomic databases

PaxDbiP0DMM9
PeptideAtlasiP0DMM9
PRIDEiP0DMM9
TopDownProteomicsiP0DMM9-2 [P0DMM9-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338971; ENSP00000343645; ENSG00000261052 [P0DMM9-1]
ENST00000395138; ENSP00000378570; ENSG00000261052 [P0DMM9-1]
ENST00000563322; ENSP00000454518; ENSG00000261052 [P0DMM9-3]
GeneIDi445329
6818
KEGGihsa:445329
hsa:6818
UCSCiuc010bzt.4 human [P0DMM9-1]

Organism-specific databases

CTDi445329
6818
DisGeNETi105369243
445329
6818
EuPathDBiHostDB:ENSG00000261052.5
GeneCardsiSULT1A3
HGNCiHGNC:11455 SULT1A3
HPAiHPA049500
HPA051051
MIMi600641 gene
neXtProtiNX_P0DMM9
OpenTargetsiENSG00000261052
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1584 Eukaryota
ENOG4111H56 LUCA
GeneTreeiENSGT00760000118932
KOiK01014
OMAiVHFDNMK
PhylomeDBiP0DMM9

Enzyme and pathway databases

BioCyciMetaCyc:HS05608-MONOMER
ReactomeiR-HSA-156584 Cytosolic sulfonation of small molecules
R-HSA-381038 XBP1(S) activates chaperone genes

Miscellaneous databases

PROiPR:P0DMM9
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000261052 Expressed in 93 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_SULT1A3
HS_SULT1A4
ExpressionAtlasiP0DMM9 baseline and differential
GenevisibleiP0DMM9 HS

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR000863 Sulfotransferase_dom
PfamiView protein in Pfam
PF00685 Sulfotransfer_1, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiST1A3_HUMAN
AccessioniPrimary (citable) accession number: P0DMM9
Secondary accession number(s): B4DNV0
, O95603, P50224, Q1ET66, Q6ZWJ5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 3, 2014
Last sequence update: September 3, 2014
Last modified: November 7, 2018
This is version 40 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again