Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myocardial zonula adherens protein

Gene

MYZAP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in cellular signaling via Rho-related GTP-binding proteins and subsequent activation of transcription factor SRF (By similarity). Targets TJP1 to cell junctions. In cortical neurons, may play a role in glutaminergic signal transduction through interaction with the NMDA receptor subunit GRIN1 (By similarity).By similarity

Miscellaneous

The adjacent MYZAP and POLR2M genes are part of a complex transcription unit. The respective transcripts derive from different promoters and are alternatively spliced. In human, some transcripts of the upstream promoter of MYZAP use exons of the downstream POLR2M gene.

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Myocardial zonula adherens protein
Alternative name(s):
GRINL1A upstream protein
Short name:
Gup
Gene namesi
Name:MYZAP
Synonyms:MYOZAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000263155.5
HGNCiHGNC:43444 MYZAP
MIMi614071 gene
neXtProtiNX_P0CAP1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi436Q → G: No effect on DYNLL1-binding; when associated with G-448. 1 Publication1
Mutagenesisi448R → G: No effect on DYNLL1-binding; when associated with G-436. 1 Publication1
Mutagenesisi450Y → G: No effect on DYNLL1-binding. 1 Publication1

Organism-specific databases

DisGeNETi100820829
145781
OpenTargetsiENSG00000137878
ENSG00000263155
PharmGKBiPA28986

Polymorphism and mutation databases

BioMutaiMYZAP
DMDMi238064959

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 20Sequence analysisAdd BLAST20
ChainiPRO_000037601321 – 466Myocardial zonula adherens proteinAdd BLAST446

Proteomic databases

MaxQBiP0CAP1
PaxDbiP0CAP1
PeptideAtlasiP0CAP1
PRIDEiP0CAP1
ProteomicsDBi52417
52418 [P0CAP1-10]
52419 [P0CAP1-11]
52420 [P0CAP1-2]
52421 [P0CAP1-3]
52422 [P0CAP1-4]
52423 [P0CAP1-5]
52424 [P0CAP1-6]
52425 [P0CAP1-7]
52426 [P0CAP1-8]
52427 [P0CAP1-9]
TopDownProteomicsiP0CAP1-7 [P0CAP1-7]

PTM databases

iPTMnetiP0CAP1
PhosphoSitePlusiP0CAP1

Expressioni

Tissue specificityi

Detected in heart, liver, skeletal muscle, placenta, small intestine, lung, prostate and testis.2 Publications

Gene expression databases

BgeeiENSG00000263155 Expressed in 181 organ(s), highest expression level in left ventricle myocardium
ExpressionAtlasiP0CAP1 baseline and differential
GenevisibleiP0CAP1 HS

Organism-specific databases

HPAiHPA039827

Interactioni

Subunit structurei

Interacts with DSP, MPRIP and TJP1/ZO1. Interaction with MPRIP inhibits the activation of transcription factor SRF (By similarity). Interacts with GRIN1. Interacts with DYNLL1.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
DYNLL1P631676EBI-7929343,EBI-349105

Protein-protein interaction databases

BioGridi123498, 66 interactors
126937, 3 interactors
IntActiP0CAP1, 3 interactors
MINTiP0CAP1
STRINGi9606.ENSP00000267853

Structurei

Secondary structure

1466
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP0CAP1
SMRiP0CAP1
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP0CAP1

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili96 – 142Sequence analysisAdd BLAST47
Coiled coili174 – 418Sequence analysisAdd BLAST245

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi424 – 425Required for DYNLL1-binding2

Sequence similaritiesi

Belongs to the MYZAP family.Curated

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

eggNOGiENOG410II7W Eukaryota
ENOG410ZUQB LUCA
GeneTreeiENSGT00530000063232
InParanoidiP0CAP1
KOiK22031
OrthoDBiEOG091G01MP
PhylomeDBiP0CAP1

Family and domain databases

InterProiView protein in InterPro
IPR028273 Myozap
PANTHERiPTHR23171:SF2 PTHR23171:SF2, 1 hit

Sequences (11+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 11 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 11 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P0CAP1-1) [UniParc]FASTAAdd to basket
Also known as: Gcom8, Gup1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLRSTSTVTL LSGGAARTPG APSRRANVCR LRLTVPPESP VPEQCEKKIE
60 70 80 90 100
RKEQLLDLSN GEPTRKLPQG VVYGVVRRSD QNQQKEMVVY GWSTSQLKEE
110 120 130 140 150
MNYIKDVRAT LEKVRKRMYG DYDEMRQKIR QLTQELSVSH AQQEYLENHI
160 170 180 190 200
QTQSSALDRF NAMNSALASD SIGLQKTLVD VTLENSNIKD QIRNLQQTYE
210 220 230 240 250
ASMDKLREKQ RQLEVAQVEN QLLKMKVESS QEANAEVMRE MTKKLYSQYE
260 270 280 290 300
EKLQEEQRKH SAEKEALLEE TNSFLKAIEE ANKKMQAAEI SLEEKDQRIG
310 320 330 340 350
ELDRLIERME KERHQLQLQL LEHETEMSGE LTDSDKERYQ QLEEASASLR
360 370 380 390 400
ERIRHLDDMV HCQQKKVKQM VEEIESLKKK LQQKQLLILQ LLEKISFLEG
410 420 430 440 450
ENNELQSRLD YLTETQAKTE VETREIGVGC DLLPSQTGRT REIVMPSRNY
460
TPYTRVLELT MKKTLT
Length:466
Mass (Da):54,206
Last modified:May 26, 2009 - v1
Checksum:i2A6B9C464B8641B4
GO
Isoform 2 (identifier: P0CAP1-2) [UniParc]FASTAAdd to basket
Also known as: Gcom2

The sequence of this isoform differs from the canonical sequence as follows:
     435-466: SQTGRTREIVMPSRNYTPYTRVLELTMKKTLT → RRCKQSSQRKN

Show »
Length:445
Mass (Da):51,824
Checksum:iB5586CECD9FE1E47
GO
Isoform 3 (identifier: P0CAP1-3) [UniParc]FASTAAdd to basket
Also known as: Gcom13

The sequence of this isoform differs from the canonical sequence as follows:
     108-138: Missing.

Show »
Length:435
Mass (Da):50,381
Checksum:i50120C5144877080
GO
Isoform 4 (identifier: P0CAP1-4) [UniParc]FASTAAdd to basket
Also known as: Gcom9, Gup2

The sequence of this isoform differs from the canonical sequence as follows:
     374-401: Missing.

Show »
Length:438
Mass (Da):50,913
Checksum:iC87A8E4F6C075852
GO
Isoform 5 (identifier: P0CAP1-5) [UniParc]FASTAAdd to basket
Also known as: Gcom10

The sequence of this isoform differs from the canonical sequence as follows:
     375-466: ESLKKKLQQK...LELTMKKTLT → MSHELFSRFSLRLFGR

Show »
Length:390
Mass (Da):45,519
Checksum:i8188CE8C6E4A4EBF
GO
Isoform 6 (identifier: P0CAP1-6) [UniParc]FASTAAdd to basket
Also known as: Gcom3

The sequence of this isoform differs from the canonical sequence as follows:
     402-466: NNELQSRLDY...LELTMKKTLT → GRKGLKGRLKMSC

Show »
Length:414
Mass (Da):48,149
Checksum:iA2F670D7A9752679
GO
Isoform 7 (identifier: P0CAP1-7) [UniParc]FASTAAdd to basket
Also known as: Gcom4

The sequence of this isoform differs from the canonical sequence as follows:
     402-466: NNELQSRLDYLTETQAKTEVETREIGVGCDLLPSQTGRTREIVMPSRNYTPYTRVLELTMKKTLT → VTFSTK

Show »
Length:407
Mass (Da):47,397
Checksum:i498D9F157C6B072E
GO
Isoform 8 (identifier: P0CAP1-8) [UniParc]FASTAAdd to basket
Also known as: Gcom5

The sequence of this isoform differs from the canonical sequence as follows:
     374-466: IESLKKKLQQ...LELTMKKTLT → VTFSTK

Show »
Length:379
Mass (Da):44,104
Checksum:i981B1A2DA4E222F9
GO
Isoform 9 (identifier: P0CAP1-9) [UniParc]FASTAAdd to basket
Also known as: Gcom6

The sequence of this isoform differs from the canonical sequence as follows:
     108-138: Missing.
     374-401: Missing.
     435-466: SQTGRTREIVMPSRNYTPYTRVLELTMKKTLT → RQSRKFEKVLNEFVQLLPLPHHLLWAFGNVCWRRHFGLLQ

Show »
Length:415
Mass (Da):48,231
Checksum:iF58E12AF16EE9267
GO
Isoform 10 (identifier: P0CAP1-10) [UniParc]FASTAAdd to basket
Also known as: Gcom11

The sequence of this isoform differs from the canonical sequence as follows:
     107-175: Missing.

Show »
Length:397
Mass (Da):46,224
Checksum:i9F313D3BC8F5CBEF
GO
Isoform 11 (identifier: P0CAP1-11) [UniParc]FASTAAdd to basket
Also known as: Gcom1, GRINL1A complex locus protein 1

The sequence of this isoform differs from the canonical sequence as follows:
     435-466: SQTGRTREIVMPSRNYTPYTRVLELTMKKTLT → RLPFRQNDSS...EDDDWSSDEF

Note: Based on a naturally occurring readthrough transcript which produces a MYZAP-POLR2M fusion protein.
Show »
Length:550
Mass (Da):64,046
Checksum:i6A30A8464C3EA8CB
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BTD5H3BTD5_HUMAN
Myocardial zonula adherens protein
MYZAP
132Annotation score:
H0YCD3H0YCD3_HUMAN
Myocardial zonula adherens protein
MYZAP
122Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti144 – 146Missing in ADA68358 (PubMed:20093627).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_055453277A → V2 PublicationsCorresponds to variant dbSNP:rs16977629Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_037389107 – 175Missing in isoform 10. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_037390108 – 138Missing in isoform 9 and isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_037391374 – 466IESLK…KKTLT → VTFSTK in isoform 8. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_037392374 – 401Missing in isoform 4 and isoform 9. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_037393375 – 466ESLKK…KKTLT → MSHELFSRFSLRLFGR in isoform 5. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_037394402 – 466NNELQ…KKTLT → GRKGLKGRLKMSC in isoform 6. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_037395402 – 466NNELQ…KKTLT → VTFSTK in isoform 7. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_037397435 – 466SQTGR…KKTLT → RLPFRQNDSSSHCQKSGSPI SSEERRRRDKQHLDDITAAR LLPLHHMPTQLLSIEESLAL QKQQKQNYEEMQAKLAAQKL AERLNIKMRSYNPEGESSGR YREVRDEDDDWSSDEF in isoform 11. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_037398435 – 466SQTGR…KKTLT → RRCKQSSQRKN in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_037396435 – 466SQTGR…KKTLT → RQSRKFEKVLNEFVQLLPLP HHLLWAFGNVCWRRHFGLLQ in isoform 9. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY207007 mRNA Translation: AAO39707.1
AY207459 mRNA Translation: AAP41548.1
AY208913 mRNA Translation: AAP41549.1
AY237639 mRNA Translation: AAP75897.1
AY331564 mRNA Translation: AAQ76825.1
AY333779 mRNA Translation: AAQ76826.1
AY334560 mRNA Translation: AAQ76827.1
AY334561 mRNA Translation: AAQ76828.1
AY334562 mRNA Translation: AAQ76829.1
AY341345 mRNA Translation: AAQ76831.1
AY353056 mRNA Translation: AAQ76832.1
AY353057 mRNA Translation: AAQ76833.1
AY353058 mRNA Translation: AAQ76834.1
AY353060 mRNA Translation: AAQ76836.1
FJ970029 mRNA Translation: ADA68358.1
AK055535 mRNA Translation: BAB70944.1
AC025271 Genomic DNA No translation available.
AC090651 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77522.1
CH471082 Genomic DNA Translation: EAW77527.1
BC101645 mRNA Translation: AAI01646.1
BC112148 mRNA Translation: AAI12149.1
CCDSiCCDS10162.1 [P0CAP1-1]
CCDS42044.1 [P0CAP1-4]
RefSeqiNP_001018100.1, NM_001018090.6 [P0CAP1-11]
NP_001018101.1, NM_001018091.6 [P0CAP1-2]
NP_001018110.1, NM_001018100.4 [P0CAP1-1]
NP_001018112.1, NM_001018102.2
NP_689664.3, NM_152451.7 [P0CAP1-4]
UniGeneiHs.437256
Hs.702937
Hs.711270

Genome annotation databases

EnsembliENST00000267853; ENSP00000267853; ENSG00000263155 [P0CAP1-1]
ENST00000380565; ENSP00000369939; ENSG00000263155 [P0CAP1-4]
GeneIDi100820829
145781
81488
KEGGihsa:100820829
hsa:145781
UCSCiuc002aei.4 human [P0CAP1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY207007 mRNA Translation: AAO39707.1
AY207459 mRNA Translation: AAP41548.1
AY208913 mRNA Translation: AAP41549.1
AY237639 mRNA Translation: AAP75897.1
AY331564 mRNA Translation: AAQ76825.1
AY333779 mRNA Translation: AAQ76826.1
AY334560 mRNA Translation: AAQ76827.1
AY334561 mRNA Translation: AAQ76828.1
AY334562 mRNA Translation: AAQ76829.1
AY341345 mRNA Translation: AAQ76831.1
AY353056 mRNA Translation: AAQ76832.1
AY353057 mRNA Translation: AAQ76833.1
AY353058 mRNA Translation: AAQ76834.1
AY353060 mRNA Translation: AAQ76836.1
FJ970029 mRNA Translation: ADA68358.1
AK055535 mRNA Translation: BAB70944.1
AC025271 Genomic DNA No translation available.
AC090651 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77522.1
CH471082 Genomic DNA Translation: EAW77527.1
BC101645 mRNA Translation: AAI01646.1
BC112148 mRNA Translation: AAI12149.1
CCDSiCCDS10162.1 [P0CAP1-1]
CCDS42044.1 [P0CAP1-4]
RefSeqiNP_001018100.1, NM_001018090.6 [P0CAP1-11]
NP_001018101.1, NM_001018091.6 [P0CAP1-2]
NP_001018110.1, NM_001018100.4 [P0CAP1-1]
NP_001018112.1, NM_001018102.2
NP_689664.3, NM_152451.7 [P0CAP1-4]
UniGeneiHs.437256
Hs.702937
Hs.711270

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KXSNMR-A70-79[»]
ProteinModelPortaliP0CAP1
SMRiP0CAP1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123498, 66 interactors
126937, 3 interactors
IntActiP0CAP1, 3 interactors
MINTiP0CAP1
STRINGi9606.ENSP00000267853

PTM databases

iPTMnetiP0CAP1
PhosphoSitePlusiP0CAP1

Polymorphism and mutation databases

BioMutaiMYZAP
DMDMi238064959

Proteomic databases

MaxQBiP0CAP1
PaxDbiP0CAP1
PeptideAtlasiP0CAP1
PRIDEiP0CAP1
ProteomicsDBi52417
52418 [P0CAP1-10]
52419 [P0CAP1-11]
52420 [P0CAP1-2]
52421 [P0CAP1-3]
52422 [P0CAP1-4]
52423 [P0CAP1-5]
52424 [P0CAP1-6]
52425 [P0CAP1-7]
52426 [P0CAP1-8]
52427 [P0CAP1-9]
TopDownProteomicsiP0CAP1-7 [P0CAP1-7]

Protocols and materials databases

DNASUi81488
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000267853; ENSP00000267853; ENSG00000263155 [P0CAP1-1]
ENST00000380565; ENSP00000369939; ENSG00000263155 [P0CAP1-4]
GeneIDi100820829
145781
81488
KEGGihsa:100820829
hsa:145781
UCSCiuc002aei.4 human [P0CAP1-1]

Organism-specific databases

CTDi100820829
145781
81488
DisGeNETi100820829
145781
EuPathDBiHostDB:ENSG00000263155.5
GeneCardsiMYZAP
HGNCiHGNC:43444 MYZAP
HPAiHPA039827
MIMi614071 gene
neXtProtiNX_P0CAP1
OpenTargetsiENSG00000137878
ENSG00000263155
PharmGKBiPA28986
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410II7W Eukaryota
ENOG410ZUQB LUCA
GeneTreeiENSGT00530000063232
InParanoidiP0CAP1
KOiK22031
OrthoDBiEOG091G01MP
PhylomeDBiP0CAP1

Miscellaneous databases

ChiTaRSiMYZAP human
EvolutionaryTraceiP0CAP1
GeneWikiiGRINL1A
PROiPR:P0CAP1
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000263155 Expressed in 181 organ(s), highest expression level in left ventricle myocardium
ExpressionAtlasiP0CAP1 baseline and differential
GenevisibleiP0CAP1 HS

Family and domain databases

InterProiView protein in InterPro
IPR028273 Myozap
PANTHERiPTHR23171:SF2 PTHR23171:SF2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMYZAP_HUMAN
AccessioniPrimary (citable) accession number: P0CAP1
Secondary accession number(s): D2E9U7
, Q6EER8, Q6EES2, Q6EEV3, Q6EF00, Q6EF01, Q6EF02, Q6EF46, Q6EFN8, Q6EM48, Q6K046, Q6K050, Q6K051, Q6ZQZ3, Q8NC58, Q8NCF3, Q96DI5, Q96JB7, Q96NF5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 26, 2009
Last sequence update: May 26, 2009
Last modified: November 7, 2018
This is version 79 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again