Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P0C7I6 (CC159_HUMAN)

Entry version 76 (16 Oct 2019)
Sequence version 2 (28 Mar 2018)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Coiled-coil domain-containing protein 159

Gene

CCDC159

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Coiled-coil domain-containing protein 159
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CCDC159
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:26996 CCDC159

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P0C7I6

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...OpenTargetsi		ENSG00000183401

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P0C7I6

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CCDC159

Domain mapping of disease mutations (DMDM)

More...DMDMi		189041677

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003329961 – 297Coiled-coil domain-containing protein 159Add BLAST297

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P0C7I6

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P0C7I6

PeptideAtlas

More...PeptideAtlasi		P0C7I6

PRoteomics IDEntifications database

More...PRIDEi		P0C7I6

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		52338 [P0C7I6-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P0C7I6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P0C7I6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000183401 Expressed in 174 organ(s), highest expression level in right adrenal gland

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P0C7I6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P0C7I6 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA047126
HPA054655

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		125955, 1 interactor

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000468232

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P0C7I6

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili147 – 297Sequence analysisAdd BLAST151

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410J016 Eukaryota
ENOG41114KW LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00390000008201

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000139146

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P0C7I6

Identification of Orthologs from Complete Genome Data

More...OMAi		PLLPSWD

Database of Orthologous Groups

More...OrthoDBi		1360515at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P0C7I6

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR039284 CCDC159/163

The PANTHER Classification System

More...PANTHERi		PTHR34533 PTHR34533, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: P0C7I6-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGEHEQVKPL ETSSSKVKAK TIVMIPDSQK LLRCELESLK SQLQAQTKAF 
        60         70         80         90        100
EFLNHSVTML EKESCLQQIK IQQLEEVLSP TGRQGEKEEH KWGMEQGRQE 
       110        120        130        140        150
LYGALTQGLQ GLEKTLRDSE EMQRARTTRC LQLLAQEIRD SKKFLWEELE 
       160        170        180        190        200
LVREEVTFIY QKLQAQEDEI SENLVNIQKM QKTQVKCRKI LTKMKQQGHE 
       210        220        230        240        250
TAACPETEEI PQGASGCWKD DLQKELSDIW SAVHVLQNSI DSLTLCSGAC 
       260        270        280        290 
PKASSLRGHK GHQCLSPPLP SWDSDSDCDQ DLSQPPFSKS GRSFPPA
Length:297
Mass (Da):33,695
Last modified:March 28, 2018 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i95D3A4E0B23F60C0
GO
Isoform 3 (identifier: P0C7I6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MGEHEQ → MNRWY
     141-177: SKKFLWEELELVREEVTFIYQKLQAQEDEISENLVNI → RSGMAGGQLGVHRREGRPRTGEWRQDGGNGRCLGEGD
     178-297: Missing.

Show »
Length:176
Mass (Da):20,071
Checksum:i9A3A3656D9C92A63
GO
Isoform 4 (identifier: P0C7I6-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MGEHEQ → MNRWY

Show »
Length:296
Mass (Da):33,734
Checksum:iD4DCE4C1384ED418
GO
Isoform 5 (identifier: P0C7I6-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-177: SKKFLWEELELVREEVTFIYQKLQAQEDEISENLVNI → RSGMAGGQLGVHRREGRPRTGEWRQDGGNGRCLGEGD
     178-297: Missing.

Show »
Length:177
Mass (Da):20,032
Checksum:i059CA67AB49C90AB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EN56K7EN56_HUMAN
Coiled-coil domain-containing prote...
CCDC159
193Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EJK8K7EJK8_HUMAN
Coiled-coil domain-containing prote...
CCDC159
155Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EKC7K7EKC7_HUMAN
Coiled-coil domain-containing prote...
CCDC159
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EKU9K7EKU9_HUMAN
Coiled-coil domain-containing prote...
CCDC159
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ENC2K7ENC2_HUMAN
Coiled-coil domain-containing prote...
CCDC159
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EKR4K7EKR4_HUMAN
Coiled-coil domain-containing prote...
CCDC159
36Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EPH8K7EPH8_HUMAN
Coiled-coil domain-containing prote...
CCDC159
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAG63130 differs from that shown. Intron retention.Curated
The sequence BC038439 differs from that shown. Cloning artifact.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_043032278C → S. Corresponds to variant dbSNP:rs6887Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0595131 – 6MGEHEQ → MNRWY in isoform 3 and isoform 4. 6
Alternative sequenceiVSP_059514141 – 177SKKFL…NLVNI → RSGMAGGQLGVHRREGRPRT GEWRQDGGNGRCLGEGD in isoform 3 and isoform 5. Add BLAST37
Alternative sequenceiVSP_059515178 – 297Missing in isoform 3 and isoform 5. Add BLAST120

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK293611 mRNA Translation: BAG57074.1
AK301653 mRNA Translation: BAG63130.1 Sequence problems.
AK303641 mRNA Translation: BAG64645.1
AK316339 mRNA Translation: BAH14710.1
AC024575 Genomic DNA No translation available.
BC038439 mRNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS45976.1 [P0C7I6-2]

NCBI Reference Sequences

More...RefSeqi		NP_001073972.2, NM_001080503.2 [P0C7I6-2]
XP_016881749.1, XM_017026260.1 [P0C7I6-7]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000458408; ENSP00000402239; ENSG00000183401 [P0C7I6-2]
ENST00000588790; ENSP00000468232; ENSG00000183401 [P0C7I6-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		126075

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:126075

UCSC genome browser

More...UCSCi		uc010xlt.3 human [P0C7I6-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK293611 mRNA Translation: BAG57074.1
AK301653 mRNA Translation: BAG63130.1 Sequence problems.
AK303641 mRNA Translation: BAG64645.1
AK316339 mRNA Translation: BAH14710.1
AC024575 Genomic DNA No translation available.
BC038439 mRNA No translation available.
CCDSiCCDS45976.1 [P0C7I6-2]
RefSeqiNP_001073972.2, NM_001080503.2 [P0C7I6-2]
XP_016881749.1, XM_017026260.1 [P0C7I6-7]

3D structure databases

SMRiP0C7I6
ModBaseiSearch...

Protein-protein interaction databases

BioGridi125955, 1 interactor
STRINGi9606.ENSP00000468232

PTM databases

iPTMnetiP0C7I6
PhosphoSitePlusiP0C7I6

Polymorphism and mutation databases

BioMutaiCCDC159
DMDMi189041677

Proteomic databases

MassIVEiP0C7I6
PaxDbiP0C7I6
PeptideAtlasiP0C7I6
PRIDEiP0C7I6
ProteomicsDBi52338 [P0C7I6-2]

Genome annotation databases

EnsembliENST00000458408; ENSP00000402239; ENSG00000183401 [P0C7I6-2]
ENST00000588790; ENSP00000468232; ENSG00000183401 [P0C7I6-2]
GeneIDi126075
KEGGihsa:126075
UCSCiuc010xlt.3 human [P0C7I6-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		126075

GeneCards: human genes, protein and diseases

More...GeneCardsi		CCDC159
HGNCiHGNC:26996 CCDC159
HPAiHPA047126
HPA054655
neXtProtiNX_P0C7I6
OpenTargetsiENSG00000183401

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410J016 Eukaryota
ENOG41114KW LUCA
GeneTreeiENSGT00390000008201
HOGENOMiHOG000139146
InParanoidiP0C7I6
OMAiPLLPSWD
OrthoDBi1360515at2759
PhylomeDBiP0C7I6

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		126075
PharosiP0C7I6

Protein Ontology

More...PROi		PR:P0C7I6

Gene expression databases

BgeeiENSG00000183401 Expressed in 174 organ(s), highest expression level in right adrenal gland
ExpressionAtlasiP0C7I6 baseline and differential
GenevisibleiP0C7I6 HS

Family and domain databases

InterProiView protein in InterPro
IPR039284 CCDC159/163
PANTHERiPTHR34533 PTHR34533, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCC159_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P0C7I6
Secondary accession number(s): B4DEG3
, B4DWR8, B4E133, B7ZAM4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: March 28, 2018
Last modified: October 16, 2019
This is version 76 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again