Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 94 (07 Oct 2020)
Sequence version 1 (08 Apr 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ankyrin repeat and sterile alpha motif domain-containing protein 1B

Gene

Anks1b

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Isoform 2 may participate in the regulation of nucleoplasmic coilin protein interactions in neuronal and transformed cells.1 Publication
Isoform 3 can regulate global protein synthesis by altering nucleolar numbers.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Alternative name(s):
Amyloid-beta protein intracellular domain-associated protein 1
Short name:
AIDA-1
E2A-PBX1-associated protein
Short name:
EB-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Anks1b
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...
RGDi
1565556, Anks1b

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Nucleus, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi935 – 938HRKR → AAAA: Does not shuttle to the nucleus in response to NMDA stimulation. 1 Publication4
Mutagenesisi1000 – 1003RRRR → AAAA: Shuttles to the nucleus is irrespective of NMDA stimulation. 4

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003272611 – 1260Ankyrin repeat and sterile alpha motif domain-containing protein 1BAdd BLAST1260

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei310PhosphoserineBy similarity1
Modified residuei311PhosphoserineBy similarity1
Modified residuei315PhosphoserineBy similarity1
Modified residuei354PhosphoserineBy similarity1
Modified residuei365PhosphoserineCombined sources1
Modified residuei504PhosphothreonineBy similarity1
Modified residuei508PhosphoserineBy similarity1
Modified residuei511PhosphoserineBy similarity1
Modified residuei739PhosphoserineBy similarity1
Modified residuei773PhosphothreonineCombined sources1
Modified residuei775PhosphoserineCombined sources1
Modified residuei901PhosphotyrosineBy similarity1
Modified residuei974PhosphoserineBy similarity1
Modified residuei1007PhosphotyrosineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Nuclear translocation of isoform 3 requires an NMDAR-dependent proteolytic cleavage. A 35 kDa N-terminal form shuttles to the nucleus.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P0C6S7

PRoteomics IDEntifications database

More...
PRIDEi
P0C6S7

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P0C6S7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P0C6S7

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P0C6S7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 3 is brain specific and highly enriched in the postsynaptic densities (PSDs), especially in cortical, striatal and hippocampal PSDs.1 Publication

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with EPHA8 (By similarity).

Isoform 2 interacts with COIL.

Isoform 3 interacts with DLG4.

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
260815, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000056036

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P0C6S7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati2 – 31ANK 1Add BLAST30
Repeati58 – 87ANK 2Add BLAST30
Repeati91 – 120ANK 3Add BLAST30
Repeati127 – 156ANK 4Add BLAST30
Repeati160 – 189ANK 5Add BLAST30
Repeati193 – 222ANK 6Add BLAST30
Repeati225 – 254ANK 7Add BLAST30
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini810 – 876SAM 1PROSITE-ProRule annotationAdd BLAST67
Domaini884 – 949SAM 2PROSITE-ProRule annotationAdd BLAST66
Domaini1056 – 1213PIDPROSITE-ProRule annotationAdd BLAST158

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi935 – 938Nuclear localization signalBy similarity4

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0507, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P0C6S7

Database of Orthologous Groups

More...
OrthoDBi
549581at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P0C6S7

Family and domain databases

Conserved Domains Database

More...
CDDi
cd09499, SAM_AIDA1AB-like_repeat1, 1 hit
cd09500, SAM_AIDA1AB-like_repeat2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.150.50, 2 hits
1.25.40.20, 2 hits
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033636, ANKS1B
IPR002110, Ankyrin_rpt
IPR020683, Ankyrin_rpt-contain_dom
IPR036770, Ankyrin_rpt-contain_sf
IPR011993, PH-like_dom_sf
IPR006020, PTB/PI_dom
IPR001660, SAM
IPR013761, SAM/pointed_sf
IPR041880, SAM_ANKS1_repeat1
IPR041882, SAM_ANKS1_repeat2

The PANTHER Classification System

More...
PANTHERi
PTHR24174:SF3, PTHR24174:SF3, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796, Ank_2, 3 hits
PF00640, PID, 1 hit
PF00536, SAM_1, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01415, ANKYRIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248, ANK, 6 hits
SM00462, PTB, 1 hit
SM00454, SAM, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47769, SSF47769, 2 hits
SSF48403, SSF48403, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297, ANK_REP_REGION, 1 hit
PS50088, ANK_REPEAT, 5 hits
PS01179, PID, 1 hit
PS50105, SAM_DOMAIN, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P0C6S7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGKDQELLEA ARTGNVALVE KLLSGRKGGI LGGGSGPLPL SNLLSIWRGP
60 70 80 90 100
NVNCTDSSGY TALHHAALNG HKDIVLKLLQ FEASTNVADN KGYFPIHLAA
110 120 130 140 150
WKGDVEIVKI LIHHGPSHSR VNEQNNENET ALHCAAQYGH SEVVAVLLEE
160 170 180 190 200
LTDPTIRNSK LETPLDLAAL YGRLRVVKMI ISAHPNLMSC NTRKHTPLHL
210 220 230 240 250
AARNGHKAVV QVLLEAGMDV SCQTEKGSAL HEAALFGKVD VVRVLLETGI
260 270 280 290 300
DANIKDSLGR TVLDILKEHP SQKSLQIATL LQDYLEGVGR SVVLEEEHAQ
310 320 330 340 350
EDTAQETRLS SPAQSPSQKT KSETVTGELS KLLDEIKLCQ EKDYSFEDLC
360 370 380 390 400
HTISDHYLDN LSKISEEELG KNGSQSVRTS STINLSPGEV EDEEEDPNSC
410 420 430 440 450
GPTGLWEALT PCNGCRNLGF PMLAQESYPK KRNYPMEIVP SASLDTFPSE
460 470 480 490 500
NENFLCELVD TAVTKKPCSL EIARAPSPRT DNASEVAITA PGTGHHRNSS
510 520 530 540 550
TGPTPDCSPP SPDTALKNIV KVIRPQPKQR TSIVSSLDFQ RMNHNQEYFE
560 570 580 590 600
ISTSTGCTSF TSSPPVSPPT SSVETTEIKN EGAEHTDDLS QQEDDEPPKE
610 620 630 640 650
YDAGQFAGLL HGSSPACEAP ENPFHLYGKR NQGEDGQEEA SLANSPLPFK
660 670 680 690 700
QTPIENNPEP SVKKIKPKVV SRTIFHKRSH QLENHTIVGT RMSRGGSRNG
710 720 730 740 750
DQWGVNPGGF VERACTLGRI RSLPKALIDM HLSKNVSKSD SDLIAYPSKD
760 770 780 790 800
KARVNWSKSS TAERSSKDNS ERTPSFTSEW EEIDKIMNSI DVGINSELEG
810 820 830 840 850
MNGEATRPRC PVQTVGQWLE SIGLPQYENH LTANGFDNVQ FMGSNVMEDQ
860 870 880 890 900
DLLEIGILNS GHRQRILQAI QLLPKMRPIG HDGYHPTSVA EWLDSIELGD
910 920 930 940 950
YTKAFLINGY TSMDLLKKIW ELELINVLKI SLIGHRKRIL ASLGDRLHED
960 970 980 990 1000
PPQKPPRSIT LREPSGNHTP PQLSPSLSQS TYTTGGSLDV PHIIMQGDAR
1010 1020 1030 1040 1050
RRRNENYFDD IPRSKLERQM AQTGDWGEPS ITLRPPNEAT ASTPVQYWQH
1060 1070 1080 1090 1100
HPEKLIFQSC DYKAFYLGSM LIKELRGTES TQDACAKMRA NCQKSTEQMK
1110 1120 1130 1140 1150
KVPTIILSVS YKGVKFIDAA NKNIIAEHEI RNISCAAQDP EDLSTFAYIT
1160 1170 1180 1190 1200
KDLKSNHHYC HVFTAFDVNL AYEIILTLGQ AFEVAYQLAL QARKGGHSST
1210 1220 1230 1240 1250
LPESFENKPS KPIPKPRVSI RKSVQIDPSE QKTLANLPWI VEPGQEAKRG
1260
INTKYETTIF
Length:1,260
Mass (Da):139,207
Last modified:April 8, 2008 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC7C71F67C349C50D
GO
Isoform 2 (identifier: P0C6S7-2) [UniParc]FASTAAdd to basket
Also known as: AIDA-1e

The sequence of this isoform differs from the canonical sequence as follows:
     1-771: Missing.
     772-807: RTPSFTSEWEEIDKIMNSIDVGINSELEGMNGEATR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     963-1022: Missing.

Show »
Length:426
Mass (Da):48,372
Checksum:iB4B90BEC6095CD0E
GO
Isoform 3 (identifier: P0C6S7-3) [UniParc]FASTAAdd to basket
Also known as: AIDA-1d

The sequence of this isoform differs from the canonical sequence as follows:
     1-771: Missing.
     772-807: RTPSFTSEWEEIDKIMNSIDVGINSELEGMNGEATR → MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTG
     1022-1022: Q → QSSVCEIWTNQNAGFPFSAIHQVHN

Show »
Length:510
Mass (Da):57,806
Checksum:i520E4E1AD148A788
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F1M2J2F1M2J2_RAT
Ankyrin repeat and sterile alpha mo...
Anks1b
1,216Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0327201 – 771Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST771
Alternative sequenceiVSP_032721772 – 807RTPSF…GEATR → MMWQCHLSAQDYRYYPVDGY SLLKRFPLHPLTG in isoform 2 and isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_032723963 – 1022Missing in isoform 2. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_0327221022Q → QSSVCEIWTNQNAGFPFSAI HQVHN in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AABR03061338 Genomic DNA No translation available.
AABR03058184 Genomic DNA No translation available.
AABR03058315 Genomic DNA No translation available.
AABR03059811 Genomic DNA No translation available.
AABR03060233 Genomic DNA No translation available.
AABR03056177 Genomic DNA No translation available.
AABR03057703 Genomic DNA No translation available.
AABR03056626 Genomic DNA No translation available.
AABR03056332 Genomic DNA No translation available.
AABR03055414 Genomic DNA No translation available.
AABR03055479 Genomic DNA No translation available.
AABR03055359 Genomic DNA No translation available.
AABR03058062 Genomic DNA No translation available.

NCBI Reference Sequences

More...
RefSeqi
XP_006241311.1, XM_006241249.3 [P0C6S7-2]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
314721

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AABR03061338 Genomic DNA No translation available.
AABR03058184 Genomic DNA No translation available.
AABR03058315 Genomic DNA No translation available.
AABR03059811 Genomic DNA No translation available.
AABR03060233 Genomic DNA No translation available.
AABR03056177 Genomic DNA No translation available.
AABR03057703 Genomic DNA No translation available.
AABR03056626 Genomic DNA No translation available.
AABR03056332 Genomic DNA No translation available.
AABR03055414 Genomic DNA No translation available.
AABR03055479 Genomic DNA No translation available.
AABR03055359 Genomic DNA No translation available.
AABR03058062 Genomic DNA No translation available.
RefSeqiXP_006241311.1, XM_006241249.3 [P0C6S7-2]

3D structure databases

SMRiP0C6S7
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi260815, 2 interactors
STRINGi10116.ENSRNOP00000056036

PTM databases

iPTMnetiP0C6S7
PhosphoSitePlusiP0C6S7
SwissPalmiP0C6S7

Proteomic databases

PaxDbiP0C6S7
PRIDEiP0C6S7

Genome annotation databases

GeneIDi314721

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
56899
RGDi1565556, Anks1b

Phylogenomic databases

eggNOGiKOG0507, Eukaryota
InParanoidiP0C6S7
OrthoDBi549581at2759
PhylomeDBiP0C6S7

Miscellaneous databases

Protein Ontology

More...
PROi
PR:P0C6S7

Family and domain databases

CDDicd09499, SAM_AIDA1AB-like_repeat1, 1 hit
cd09500, SAM_AIDA1AB-like_repeat2, 1 hit
Gene3Di1.10.150.50, 2 hits
1.25.40.20, 2 hits
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR033636, ANKS1B
IPR002110, Ankyrin_rpt
IPR020683, Ankyrin_rpt-contain_dom
IPR036770, Ankyrin_rpt-contain_sf
IPR011993, PH-like_dom_sf
IPR006020, PTB/PI_dom
IPR001660, SAM
IPR013761, SAM/pointed_sf
IPR041880, SAM_ANKS1_repeat1
IPR041882, SAM_ANKS1_repeat2
PANTHERiPTHR24174:SF3, PTHR24174:SF3, 1 hit
PfamiView protein in Pfam
PF12796, Ank_2, 3 hits
PF00640, PID, 1 hit
PF00536, SAM_1, 2 hits
PRINTSiPR01415, ANKYRIN
SMARTiView protein in SMART
SM00248, ANK, 6 hits
SM00462, PTB, 1 hit
SM00454, SAM, 2 hits
SUPFAMiSSF47769, SSF47769, 2 hits
SSF48403, SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297, ANK_REP_REGION, 1 hit
PS50088, ANK_REPEAT, 5 hits
PS01179, PID, 1 hit
PS50105, SAM_DOMAIN, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiANS1B_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P0C6S7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: April 8, 2008
Last modified: October 7, 2020
This is version 94 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again